Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTDSYAQ)

DTP Name Calcium-binding mitochondrial carrier protein Aralar2 (SLC25A13)
Gene Name SLC25A13
UniProt ID
Q9UJS0 (CMC2_HUMAN)
VARIDT ID
DTD0171
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ARALAR2; CTLN2; Citrin; Mitochondrial aspartate glutamate carrier 2; SLC25A13; Solute carrier family 25 member 13
DTP Family Mitochondrial Carrier (MC) Family ;
Tissue Specificity High levels in liver and low levels in kidney,pancreas, placenta, heart and brain.
Sequence
MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVEL
LSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTT
IHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTA
IDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTL
AGTRKDVEVTKEEFVLAAQKFGQVTPMEVDILFQLADLYEPRGRMTLADIERIAPLEEGT
LPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTRMQNQR
STGSFVGELMYKNSFDCFKKVLRYEGFFGLYRGLLPQLLGVAPEKAIKLTVNDFVRDKFM
HKDGSVPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVRDLGFF
GIYKGAKACFLRDIPFSAIYFPCYAHVKASFANEDGQVSPGSLLLAGAIAGMPAASLVTP
ADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGPKALWKGAGARVFRSSPQFGVTLLTY
ELLQRWFYIDFGGVKPMGSEPVPKSRINLPAPNPDHVGGYKLAVATFAGIENKFGLYLPL
FKPSVSTSKAIGGGP
Function This transporter catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the mitochondrial inner membrane. May have a function in the urea cycle.
Endogenous Substrate(s) Ca2+; Aspartate
TCDB ID
2.A.29.14.2
Gene ID
10165
Reactome Pathway
Gluconeogenesis (R-HSA-70263 )
Aspartate and asparagine metabolism (R-HSA-8963693 )
Mitochondrial protein import (R-HSA-1268020 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-Glutamic Acid DM4PUDW Schizophrenia 6A20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.12E-02 -9.89E-02 -2.31E-01
Adrenocortical carcinoma 2D11.Z Kidney 5.01E-04 7.65E-01 1.11E+00
Alopecia ED70 Skin from scalp 4.31E-01 -5.81E-02 -7.61E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.38E-01 7.32E-02 1.12E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.01E-01 3.44E-01 1.27E+00
Aortic stenosis BB70 Calcified aortic valve 2.54E-01 -4.02E-02 -1.53E-01
Apnea 7A40 Hyperplastic tonsil 4.15E-01 -1.11E-02 -3.84E-02
Arthropathy FA00-FA5Z Peripheral blood 6.75E-01 -3.32E-03 -1.84E-02
Asthma CA23 Nasal and bronchial airway 9.76E-01 5.00E-02 7.78E-02
Atopic dermatitis EA80 Skin 2.02E-07 -2.62E-01 -1.20E+00
Autism 6A02 Whole blood 4.55E-02 1.29E-01 5.49E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.31E-01 4.18E-01 2.12E+00
Autosomal dominant monocytopenia 4B04 Whole blood 4.04E-01 4.76E-01 4.04E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.97E-09 -3.37E-01 -8.80E-01
Batten disease 5C56.1 Whole blood 1.86E-01 6.08E-02 7.56E-01
Behcet's disease 4A62 Peripheral blood 4.74E-01 1.59E-02 6.40E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.38E-01 -2.87E-02 -7.24E-02
Bladder cancer 2C94 Bladder tissue 5.68E-03 4.35E-01 1.24E+00
Breast cancer 2C60-2C6Z Breast tissue 6.76E-55 6.91E-01 1.40E+00
Cardioembolic stroke 8B11.20 Whole blood 3.88E-07 -3.37E-01 -1.77E+00
Cervical cancer 2C77 Cervical tissue 9.10E-04 2.51E-01 5.28E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.58E-01 -1.80E-01 -4.00E-01
Chronic hepatitis C 1E51.1 Whole blood 4.27E-01 -1.50E-01 -5.14E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.78E-01 -1.96E-02 -5.50E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.23E-01 9.59E-02 2.59E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.05E-01 -2.28E-02 -6.81E-02
Colon cancer 2B90 Colon tissue 5.19E-01 -1.68E-02 -3.21E-02
Coronary artery disease BA80-BA8Z Peripheral blood 1.75E-01 -3.85E-01 -7.78E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.10E-01 -3.72E-01 -7.03E-01
Endometriosis GA10 Endometrium tissue 7.32E-01 -1.67E-01 -2.49E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.13E-01 9.39E-02 6.80E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.24E-05 1.42E+00 2.01E+00
Gastric cancer 2B72 Gastric tissue 3.82E-01 1.19E-01 1.29E-01
Glioblastopma 2A00.00 Nervous tissue 7.03E-64 1.15E+00 1.33E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.73E-01 -6.75E-01 -1.00E+00
Head and neck cancer 2D42 Head and neck tissue 1.93E-08 2.09E-01 6.44E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.28E-01 2.99E-01 2.79E-01
Huntington's disease 8A01.10 Whole blood 9.72E-01 8.83E-03 9.93E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.53E-01 -3.69E-03 -5.94E-02
Immunodeficiency 4A00-4A20 Peripheral blood 7.96E-01 -9.33E-03 -8.70E-02
Influenza 1.00E+30 Whole blood 2.86E-03 -9.50E-01 -1.28E+01
Interstitial cystitis GC00.3 Bladder tissue 2.13E-01 -1.76E-02 -6.31E-02
Intracranial aneurysm 8B01.0 Intracranial artery 6.30E-01 6.57E-02 1.42E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.82E-01 -4.77E-03 -1.71E-02
Ischemic stroke 8B11 Peripheral blood 9.25E-02 -8.70E-02 -2.76E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.91E-03 9.63E-02 1.51E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.14E-01 -1.49E-02 -5.65E-02
Lateral sclerosis 8B60.4 Skin 7.18E-01 -8.11E-02 -4.15E-01
Liver cancer 2C12.0 Liver tissue 8.09E-01 -1.46E-01 -1.93E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.59E-01 -2.99E-01 -8.57E-01
Lung cancer 2C25 Lung tissue 8.77E-83 9.47E-01 2.21E+00
Lupus erythematosus 4A40 Whole blood 1.24E-03 2.78E-01 3.59E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.15E-01 2.66E-02 1.13E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.94E-01 -3.31E-02 -8.39E-02
Melanoma 2C30 Skin 1.56E-02 5.40E-01 4.16E-01
Multiple myeloma 2A83.1 Bone marrow 2.43E-04 2.21E-01 1.53E+00
Multiple myeloma 2A83.1 Peripheral blood 3.52E-01 -1.01E-01 -3.37E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.15E-01 -8.23E-02 -3.73E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.69E-01 1.55E-02 8.55E-02
Myelofibrosis 2A20.2 Whole blood 8.63E-01 6.73E-02 3.74E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.45E-02 -3.48E-01 -5.40E-01
Myopathy 8C70.6 Muscle tissue 6.57E-01 1.27E-01 3.55E-01
Neonatal sepsis KA60 Whole blood 1.36E-06 1.42E-01 4.45E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.41E-02 -5.01E-01 -1.10E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.91E-01 1.34E-02 2.33E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.88E-01 1.11E-01 3.74E-01
Olive pollen allergy CA08.00 Peripheral blood 2.61E-01 1.17E-02 4.97E-02
Oral cancer 2B6E Oral tissue 7.56E-15 1.16E+00 2.87E+00
Osteoarthritis FA00-FA0Z Synovial tissue 2.44E-01 9.07E-02 1.28E-01
Osteoporosis FB83.1 Bone marrow 3.19E-01 -3.22E-01 -6.01E-01
Ovarian cancer 2C73 Ovarian tissue 1.06E-01 3.46E-01 8.62E-01
Pancreatic cancer 2C10 Pancreas 3.01E-05 5.81E-01 1.46E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 4.64E-02 -3.72E-01 -9.94E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.12E-04 2.97E-01 1.67E+00
Pituitary cancer 2D12 Pituitary tissue 8.73E-01 9.28E-02 1.82E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.01E-01 1.30E-01 2.53E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.51E-01 2.32E-02 1.04E-01
Polycythemia vera 2A20.4 Whole blood 1.23E-01 -1.35E-01 -6.56E-01
Pompe disease 5C51.3 Biceps muscle 5.00E-03 3.23E-01 5.57E+00
Preterm birth KA21.4Z Myometrium 8.94E-01 1.00E-01 4.40E-01
Prostate cancer 2C82 Prostate 3.90E-06 7.94E-01 1.27E+00
Psoriasis EA90 Skin 3.60E-14 5.42E-01 9.71E-01
Rectal cancer 2B92 Rectal colon tissue 3.10E-01 1.92E-01 1.02E+00
Renal cancer 2C90-2C91 Kidney 8.79E-02 3.07E-01 7.29E-01
Retinoblastoma 2D02.2 Uvea 4.54E-03 4.20E-01 2.70E+00
Rheumatoid arthritis FA20 Synovial tissue 1.16E-03 1.44E+00 2.48E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.65E-01 -4.09E-02 -2.08E-01
Schizophrenia 6A20 Prefrontal cortex 4.86E-01 3.05E-02 5.89E-02
Schizophrenia 6A20 Superior temporal cortex 3.31E-02 -1.95E-01 -4.59E-01
Scleroderma 4A42.Z Whole blood 1.83E-02 -2.81E-01 -8.23E-01
Seizure 8A60-8A6Z Whole blood 4.10E-05 -5.48E-01 -2.30E+00
Sensitive skin EK0Z Skin 4.13E-01 1.68E-01 4.96E-01
Sepsis with septic shock 1G41 Whole blood 7.76E-02 2.31E-02 6.17E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.07E-02 -1.24E-01 -6.92E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.51E-02 9.70E-02 8.45E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.53E-01 -2.72E-01 -1.22E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.15E-02 -5.50E-01 -1.48E+00
Skin cancer 2C30-2C3Z Skin 3.26E-33 9.78E-01 1.90E+00
Thrombocythemia 3B63 Whole blood 5.75E-01 -9.39E-02 -4.10E-01
Thrombocytopenia 3B64 Whole blood 9.57E-01 7.56E-02 1.93E-01
Thyroid cancer 2D10 Thyroid 1.23E-09 2.94E-01 5.67E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.73E-01 1.82E-01 4.45E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.71E-01 1.89E-01 4.52E-01
Type 2 diabetes 5A11 Liver tissue 9.10E-01 7.15E-02 1.92E-01
Ureter cancer 2C92 Urothelium 3.79E-02 1.80E-02 9.13E-02
Uterine cancer 2C78 Endometrium tissue 6.16E-02 8.14E-02 1.09E-01
Vitiligo ED63.0 Skin 4.38E-01 5.40E-02 3.50E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Epigenetic upregulation and functional role of the mitochondrial aspartate/glutamate carrier isoform 1 in hepatocellular carcinoma. Biochim Biophys Acta Mol Basis Dis. 2019 Jan;1865(1):38-47.