Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTDVSJA)

DTP Name ATP-binding cassette sub-family A member 7 (ABCA7)
Gene Name ABCA7
UniProt ID
Q8IZY2 (ABCA7_HUMAN)
VARIDT ID
DTD0045
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ABCA-SSN; ABCA7; ABCX; AD9; Autoantigen SS-N; Macrophage ABC transporter
DTP Family ATP-Binding Cassette (ABC) Superfamily ;
Tissue Specificity Expressed in leukocytes (at protein level).Widely expressed. Highly expressed in myelo-lymphatic tissuesincluding peripheral leukocytes, thymus, spleen and bone marrow.Isoform 2 is more abundant in lymph node, spleen, thymus andtrachea than isoform 1 which is more strongly expressed in brainand bone marrow.
Sequence
MAFWTQLMLLLWKNFMYRRRQPVQLLVELLWPLFLFFILVAVRHSHPPLEHHECHFPNKP
LPSAGTVPWLQGLICNVNNTCFPQLTPGEEPGRLSNFNDSLVSRLLADARTVLGGASAHR
TLAGLGKLIATLRAARSTAQPQPTKQSPLEPPMLDVAELLTSLLRTESLGLALGQAQEPL
HSLLEAAEDLAQELLALRSLVELRALLQRPRGTSGPLELLSEALCSVRGPSSTVGPSLNW
YEASDLMELVGQEPESALPDSSLSPACSELIGALDSHPLSRLLWRRLKPLILGKLLFAPD
TPFTRKLMAQVNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRR
QPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHLVGTLGRVTECLSLDKLEAAPSEAA
LVSRALQLLAEHRFWAGVVFLGPEDSSDPTEHPTPDLGPGHVRIKIRMDIDVVTRTNKIR
DRFWDPGPAADPLTDLRYVWGGFVYLQDLVERAAVRVLSGANPRAGLYLQQMPYPCYVDD
VFLRVLSRSLPLFLTLAWIYSVTLTVKAVVREKETRLRDTMRAMGLSRAVLWLGWFLSCL
GPFLLSAALLVLVLKLGDILPYSHPGVVFLFLAAFAVATVTQSFLLSAFFSRANLAAACG
GLAYFSLYLPYVLCVAWRDRLPAGGRVAASLLSPVAFGFGCESLALLEEQGEGAQWHNVG
TRPTADVFSLAQVSGLLLLDAALYGLATWYLEAVCPGQYGIPEPWNFPFRRSYWCGPRPP
KSPAPCPTPLDPKVLVEEAPPGLSPGVSVRSLEKRFPGSPQPALRGLSLDFYQGHITAFL
GHNGAGKTTTLSILSGLFPPSGGSAFILGHDVRSSMAAIRPHLGVCPQYNVLFDMLTVDE
HVWFYGRLKGLSAAVVGPEQDRLLQDVGLVSKQSVQTRHLSGGMQRKLSVAIAFVGGSQV
VILDEPTAGVDPASRRGIWELLLKYREGRTLILSTHHLDEAELLGDRVAVVAGGRLCCCG
SPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLA
LVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLE
EIFLKVVEECAADTDMEDGSCGQHLCTGIAGLDVTLRLKMPPQETALENGEPAGSAPETD
QGSGPDAVGRVQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIV
PPFGHYPALRLSPTMYGAQVSFFSEDAPGDPGRARLLEALLQEAGLEEPPVQHSSHRFSA
PEVPAEVAKVLASGNWTPESPSPACQCSRPGARRLLPDCPAAAGGPPPPQAVTGSGEVVQ
NLTGRNLSDFLVKTYPRLVRQGLKTKKWVNEVRYGGFSLGGRDPGLPSGQELGRSVEELW
ALLSPLPGGALDRVLKNLTAWAHSLDAQDSLKIWFNNKGWHSMVAFVNRASNAILRAHLP
PGPARHAHSITTLNHPLNLTKEQLSEGALMASSVDVLVSICVVFAMSFVPASFTLVLIEE
RVTRAKHLQLMGGLSPTLYWLGNFLWDMCNYLVPACIVVLIFLAFQQRAYVAPANLPALL
LLLLLYGWSITPLMYPASFFFSVPSTAYVVLTCINLFIGINGSMATFVLELFSDQKLQEV
SRILKQVFLIFPHFCLGRGLIDMVRNQAMADAFERLGDRQFQSPLRWEVVGKNLLAMVIQ
GPLFLLFTLLLQHRSQLLPQPRVRSLPLLGEEDEDVARERERVVQGATQGDVLVLRNLTK
VYRGQRMPAVDRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLASRGEAVLAGHSVAR
EPSAAHLSMGYCPQSDAIFELLTGREHLELLARLRGVPEAQVAQTAGSGLARLGLSWYAD
RPAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLAVVREGRSVML
TSHSMEECEALCSRLAIMVNGRFRCLGSPQHLKGRFAAGHTLTLRVPAARSQPAAAFVAA
EFPGAELREAHGGRLRFQLPPGGRCALARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYF
SKDQGKDEDTEEQKEAGVGVDPAPGLQHPKRVSQFLDDPSTAETVL
Function
This transporter is probable ATP-binding cassette (ABC) transporter that plays a role in lipid homeostasis and macrophage-mediated phagocytosis ang binds APOA1 and may function in apolipoprotein-mediated phospholipid efflux from cells and may also mediate cholesterol efflux.
Endogenous Substrate(s) Phospholipids
TCDB ID
3.A.1.211.10
Gene ID
10347
KEGG Pathway
ABC transporters (hsa02010 )
Reactome Pathway
ABC transporters in lipid homeostasis (R-HSA-1369062 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.61E-25 -5.44E-01 -1.53E+00
Adrenocortical carcinoma 2D11.Z Kidney 1.10E-01 7.02E-02 1.80E-01
Alopecia ED70 Skin from scalp 5.59E-01 2.11E-02 5.18E-02
Alzheimer's disease 8A20 Entorhinal cortex 5.28E-02 8.56E-02 2.94E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.64E-01 1.56E-02 9.67E-02
Aortic stenosis BB70 Calcified aortic valve 4.03E-01 2.72E-01 1.00E+00
Apnea 7A40 Hyperplastic tonsil 5.43E-01 4.27E-01 9.40E-01
Arthropathy FA00-FA5Z Peripheral blood 7.87E-01 1.46E-02 3.67E-02
Asthma CA23 Nasal and bronchial airway 9.29E-02 2.94E-01 3.22E-01
Atopic dermatitis EA80 Skin 1.99E-14 9.92E-01 2.97E+00
Autism 6A02 Whole blood 4.69E-01 1.73E-01 3.56E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.48E-02 5.47E-01 1.53E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.31E-01 -6.30E-01 -8.10E-01
Bacterial infection of gingival 1C1H Gingival tissue 6.08E-05 2.91E-01 7.82E-01
Batten disease 5C56.1 Whole blood 5.37E-02 3.60E-01 1.62E+00
Behcet's disease 4A62 Peripheral blood 7.13E-01 -1.01E-01 -3.55E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.07E-01 5.34E-02 3.17E-01
Bladder cancer 2C94 Bladder tissue 5.35E-03 5.53E-01 1.49E+00
Breast cancer 2C60-2C6Z Breast tissue 4.35E-33 3.21E-01 7.75E-01
Cardioembolic stroke 8B11.20 Whole blood 1.39E-02 -1.94E-01 -4.79E-01
Cervical cancer 2C77 Cervical tissue 2.37E-02 -3.75E-01 -5.26E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.04E-01 7.01E-02 8.13E-02
Chronic hepatitis C 1E51.1 Whole blood 1.75E-01 -7.30E-02 -4.42E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.12E-01 -1.64E-01 -3.60E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.77E-01 8.72E-02 1.69E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.51E-02 1.57E-01 3.40E-01
Colon cancer 2B90 Colon tissue 5.65E-15 2.27E-01 6.95E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.18E-02 3.52E-01 1.83E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.90E-01 -1.37E-01 -1.68E-01
Endometriosis GA10 Endometrium tissue 4.56E-01 6.02E-02 2.00E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.28E-01 1.64E-01 6.44E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.58E-02 1.96E-01 6.46E-01
Gastric cancer 2B72 Gastric tissue 1.69E-02 5.61E-01 3.94E+00
Glioblastopma 2A00.00 Nervous tissue 1.31E-39 -3.97E-01 -9.32E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.47E-03 -4.98E-01 -1.50E+00
Head and neck cancer 2D42 Head and neck tissue 2.71E-14 -5.55E-01 -9.68E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.01E-02 2.49E-01 7.98E-01
Huntington's disease 8A01.10 Whole blood 1.32E-01 -3.03E-01 -6.05E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.54E-01 1.26E-01 1.03E+00
Immunodeficiency 4A00-4A20 Peripheral blood 9.75E-03 -3.99E-01 -2.23E+00
Influenza 1.00E+30 Whole blood 6.80E-02 3.93E-01 2.01E+00
Interstitial cystitis GC00.3 Bladder tissue 1.54E-03 4.55E-01 1.78E+00
Intracranial aneurysm 8B01.0 Intracranial artery 7.27E-03 6.30E-01 1.80E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.30E-01 -4.97E-03 -2.39E-02
Ischemic stroke 8B11 Peripheral blood 8.66E-02 -1.68E-01 -7.08E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.27E-01 -5.01E-02 -1.02E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.81E-01 1.62E-01 2.71E-01
Lateral sclerosis 8B60.4 Skin 8.35E-01 -1.17E-01 -2.64E-01
Liver cancer 2C12.0 Liver tissue 2.34E-02 2.09E-01 6.11E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.50E-04 1.12E+00 3.68E+00
Lung cancer 2C25 Lung tissue 1.36E-05 -1.66E-01 -5.20E-01
Lupus erythematosus 4A40 Whole blood 2.06E-09 5.29E-01 8.46E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.17E-01 -8.57E-02 -1.67E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.86E-01 5.10E-02 3.38E-01
Melanoma 2C30 Skin 7.37E-03 -5.71E-01 -8.67E-01
Multiple myeloma 2A83.1 Bone marrow 1.93E-03 6.52E-01 1.93E+00
Multiple myeloma 2A83.1 Peripheral blood 9.15E-01 1.87E-01 5.42E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.57E-01 -1.73E-01 -4.06E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.75E-05 2.05E-01 1.00E+00
Myelofibrosis 2A20.2 Whole blood 5.53E-01 -7.69E-02 -2.91E-01
Myocardial infarction BA41-BA50 Peripheral blood 6.96E-02 2.12E-01 4.58E-01
Myopathy 8C70.6 Muscle tissue 6.10E-01 -1.07E-02 -6.90E-02
Neonatal sepsis KA60 Whole blood 3.76E-01 9.12E-02 1.45E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.88E-08 3.30E-01 2.24E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.54E-01 1.13E-01 5.61E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.29E-01 1.12E-01 5.99E-01
Olive pollen allergy CA08.00 Peripheral blood 6.02E-01 1.27E-01 3.99E-01
Oral cancer 2B6E Oral tissue 5.39E-08 -7.43E-01 -1.29E+00
Osteoarthritis FA00-FA0Z Synovial tissue 8.39E-01 6.69E-03 1.34E-02
Osteoporosis FB83.1 Bone marrow 3.83E-02 2.63E-01 1.23E+00
Ovarian cancer 2C73 Ovarian tissue 3.82E-01 1.26E-01 4.46E-01
Pancreatic cancer 2C10 Pancreas 3.61E-01 2.78E-01 3.87E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.82E-01 1.76E-01 6.49E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.91E-02 -1.38E-01 -5.43E-01
Pituitary cancer 2D12 Pituitary tissue 6.36E-01 -2.86E-02 -5.71E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.41E-01 -3.32E-02 -6.50E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.37E-01 2.92E-03 6.31E-03
Polycythemia vera 2A20.4 Whole blood 3.20E-01 4.05E-02 1.46E-01
Pompe disease 5C51.3 Biceps muscle 8.06E-01 -3.72E-02 -1.36E-01
Preterm birth KA21.4Z Myometrium 4.29E-01 1.87E-01 3.05E-01
Prostate cancer 2C82 Prostate 9.51E-02 -9.67E-02 -1.63E-01
Psoriasis EA90 Skin 2.62E-13 4.23E-01 9.90E-01
Rectal cancer 2B92 Rectal colon tissue 4.34E-03 2.09E-01 1.34E+00
Renal cancer 2C90-2C91 Kidney 2.91E-02 2.23E-01 8.23E-01
Retinoblastoma 2D02.2 Uvea 5.55E-10 -3.29E+00 -5.37E+00
Rheumatoid arthritis FA20 Synovial tissue 3.40E-01 -9.73E-02 -2.21E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.07E-01 -7.90E-02 -3.54E-01
Schizophrenia 6A20 Prefrontal cortex 8.64E-02 1.20E-01 1.65E-01
Schizophrenia 6A20 Superior temporal cortex 9.36E-01 -4.37E-02 -2.64E-01
Scleroderma 4A42.Z Whole blood 2.40E-03 2.27E-01 9.66E-01
Seizure 8A60-8A6Z Whole blood 1.28E-01 1.52E-01 4.11E-01
Sensitive skin EK0Z Skin 1.90E-01 2.11E-01 1.57E+00
Sepsis with septic shock 1G41 Whole blood 5.63E-01 6.80E-02 1.16E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.93E-02 -3.75E-01 -2.09E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.44E-01 2.22E-01 5.06E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.16E-01 2.41E-01 4.48E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.71E-01 -2.41E-01 -7.73E-01
Skin cancer 2C30-2C3Z Skin 1.83E-05 1.70E-01 4.04E-01
Thrombocythemia 3B63 Whole blood 9.32E-01 1.35E-01 5.08E-01
Thrombocytopenia 3B64 Whole blood 1.74E-01 4.17E-01 7.60E-01
Thyroid cancer 2D10 Thyroid 4.38E-05 2.65E-01 5.41E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.75E-05 -5.02E-01 -2.23E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.27E-01 -9.02E-02 -5.17E-01
Type 2 diabetes 5A11 Liver tissue 8.16E-01 -7.27E-02 -1.83E-01
Ureter cancer 2C92 Urothelium 7.25E-01 -6.90E-02 -1.32E-01
Uterine cancer 2C78 Endometrium tissue 4.13E-01 3.43E-02 4.73E-02
Vitiligo ED63.0 Skin 6.98E-01 -1.68E-02 -9.16E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases