General Information of Drug Transporter (DTP) (ID: DTE3V8W)

DTP Name ATP-binding cassette sub-family A member 9 (ABCA9)
Gene Name ABCA9
UniProt ID
Q8IUA7 (ABCA9_HUMAN)
VARIDT ID
DTD0047
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ABCA9; EST640918; ATP-binding cassette A member 9
DTP Family ATP-Binding Cassette (ABC) Superfamily ;
Tissue Specificity Widely expressed with higher expression inheart.
Sequence
MSKRRMSVGQQTWALLCKNCLKKWRMKRQTLLEWLFSFLLVLFLYLFFSNLHQVHDTPQM
SSMDLGRVDSFNDTNYVIAFAPESKTTQEIMNKVASAPFLKGRTIMGWPDEKSMDELDLN
YSIDAVRVIFTDTFSYHLKFSWGHRIPMMKEHRDHSAHCQAVNEKMKCEGSEFWEKGFVA
FQAAINAAIIEIATNHSVMEQLMSVTGVHMKILPFVAQGGVATDFFIFFCIISFSTFIYY
VSVNVTQERQYITSLMTMMGLRESAFWLSWGLMYAGFILIMATLMALIVKSAQIVVLTGF
VMVFTLFLLYGLSLITLAFLMSVLIKKPFLTGLVVFLLIVFWGILGFPALYTRLPAFLEW
TLCLLSPFAFTVGMAQLIHLDYDVNSNAHLDSSQNPYLIIATLFMLVFDTLLYLVLTLYF
DKILPAEYGHRCSPLFFLKSCFWFQHGRANHVVLENETDSDPTPNDCFEPVSPEFCGKEA
IRIKNLKKEYAGKCERVEALKGVVFDIYEGQITALLGHSGAGKTTLLNILSGLSVPTSGS
VTVYNHTLSRMADIENISKFTGFCPQSNVQFGFLTVKENLRLFAKIKGILPHEVEKEVQR
VVQELEMENIQDILAQNLSGGQNRKLTFGIAILGDPQVLLLDEPTAGLDPLSRHRIWNLL
KEGKSDRVILFSTQFIDEADILADRKVFISNGKLKCAGSSLFLKKKWGIGYHLSLHLNER
CDPESITSLVKQHISDAKLTAQSEEKLVYILPLERTNKFPELYRDLDRCSNQGIEDYGVS
ITTLNEVFLKLEGKSTIDESDIGIWGQLQTDGAKDIGSLVELEQVLSSFHETRKTISGVA
LWRQQVCAIAKVRFLKLKKERKSLWTILLLFGISFIPQLLEHLFYESYQKSYPWELSPNT
YFLSPGQQPQDPLTHLLVINKTGSTIDNFLHSLRRQNIAIEVDAFGTRNGTDDPSYNGAI
IVSGDEKDHRFSIACNTKRLNCFPVLLDVISNGLLGIFNSSEHIQTDRSTFFEEHMDYEY
GYRSNTFFWIPMAASFTPYIAMSSIGDYKKKAHSQLRISGLYPSAYWFGQALVDVSLYFL
ILLLMQIMDYIFSPEEIIFIIQNLLIQILCSIGYVSSLVFLTYVISFIFRNGRKNSGIWS
FFFLIVVIFSIVATDLNEYGFLGLFFGTMLIPPFTLIGSLFIFSEISPDSMDYLGASESE
IVYLALLIPYLHFLIFLFILRCLEMNCRKKLMRKDPVFRISPRSNAIFPNPEEPEGEEED
IQMERMRTVNAMAVRDFDETPVIIASCLRKEYAGKKKNCFSKRKKKIATRNVSFCVKKGE
VIGLLGHNGAGKSTTIKMITGDTKPTAGQVILKGSGGGEPLGFLGYCPQENALWPNLTVR
QHLEVYAAVKGLRKGDAMIAITRLVDALKLQDQLKAPVKTLSEGIKRKLCFVLSILGNPS
VVLLDEPSTGMDPEGQQQMWQVIRATFRNTERGALLTTHYMAEAEAVCDRVAIMVSGRLR
CIGSIQHLKSKFGKDYLLEMKLKNLAQMEPLHAEILRLFPQAAQQERFSSLMVYKLPVED
VRPLSQAFFKLEIVKQSFDLEEYSLSQSTLEQVFLELSKEQELGDLEEDFDPSVKWKLLL
QEEP
Function This transporter may play a role in monocyte differentiation and liposomal homeostasis.
Endogenous Substrate(s) Lipids
TCDB ID
3.A.1.211.16
Gene ID
10350
KEGG Pathway
ABC transporters (hsa02010 )
Reactome Pathway
ABC transporters in lipid homeostasis (R-HSA-1369062 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.52E-01 -2.11E-02 -1.82E-01
Adrenocortical carcinoma 2D11.Z Kidney 7.10E-03 -3.07E-01 -7.41E-01
Alopecia ED70 Skin from scalp 7.92E-03 3.15E-01 5.48E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.56E-04 1.26E-01 5.62E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.43E-01 -8.73E-03 -5.95E-02
Aortic stenosis BB70 Calcified aortic valve 1.15E-01 -3.06E-01 -3.20E-01
Apnea 7A40 Hyperplastic tonsil 1.40E-01 8.98E-02 1.71E+00
Arthropathy FA00-FA5Z Peripheral blood 5.39E-01 2.20E-02 2.19E-01
Asthma CA23 Nasal and bronchial airway 1.79E-03 -1.57E-01 -2.05E-01
Atopic dermatitis EA80 Skin 1.09E-04 -5.43E-01 -1.47E+00
Autism 6A02 Whole blood 3.95E-01 -6.38E-02 -5.76E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.09E-01 -2.52E-02 -2.96E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.87E-01 1.95E-02 2.05E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.08E-01 2.01E-02 1.16E-01
Batten disease 5C56.1 Whole blood 1.30E-01 3.83E-02 5.56E-01
Behcet's disease 4A62 Peripheral blood 6.83E-02 4.49E-02 2.50E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.42E-01 4.11E-02 2.12E-01
Bladder cancer 2C94 Bladder tissue 8.20E-02 -5.72E-01 -8.69E-01
Breast cancer 2C60-2C6Z Breast tissue 8.69E-93 -2.26E+00 -2.20E+00
Cardioembolic stroke 8B11.20 Whole blood 6.95E-01 3.72E-02 1.20E-01
Cervical cancer 2C77 Cervical tissue 2.15E-01 -1.42E-02 -3.66E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.72E-01 -2.31E-02 -1.56E-01
Chronic hepatitis C 1E51.1 Whole blood 4.00E-01 1.23E-01 6.65E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.60E-01 -1.20E-01 -2.76E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.79E-01 5.07E-02 2.53E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.53E-01 3.84E-02 9.21E-02
Colon cancer 2B90 Colon tissue 4.84E-04 -4.60E-02 -1.87E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.77E-01 -7.05E-02 -5.36E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.97E-01 1.52E-02 9.82E-02
Endometriosis GA10 Endometrium tissue 1.16E-02 6.60E-02 1.23E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.57E-02 -1.06E-01 -1.54E+00
Familial hypercholesterolemia 5C80.00 Whole blood 5.69E-01 -3.28E-02 -2.41E-01
Gastric cancer 2B72 Gastric tissue 4.15E-01 -2.81E-01 -3.60E-01
Glioblastopma 2A00.00 Nervous tissue 1.46E-20 -3.43E-01 -6.16E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.59E-02 -3.52E-01 -7.43E-01
Head and neck cancer 2D42 Head and neck tissue 1.76E-07 -3.62E-01 -6.64E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.12E-01 1.10E-01 2.59E-01
Huntington's disease 8A01.10 Whole blood 4.34E-01 -4.36E-02 -4.46E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.00E-01 -2.44E-01 -3.37E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.11E-01 3.53E-02 3.59E-01
Influenza 1.00E+30 Whole blood 2.14E-02 2.56E-01 1.23E+00
Interstitial cystitis GC00.3 Bladder tissue 6.66E-01 2.12E-01 3.17E-01
Intracranial aneurysm 8B01.0 Intracranial artery 6.35E-01 5.98E-02 9.28E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.57E-01 -3.35E-02 -8.25E-02
Ischemic stroke 8B11 Peripheral blood 1.70E-01 -9.11E-02 -7.60E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.24E-01 2.30E-02 9.74E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 1.79E-01 1.19E-01 5.13E-01
Lateral sclerosis 8B60.4 Skin 1.29E-01 -2.42E-01 -1.13E+00
Liver cancer 2C12.0 Liver tissue 4.65E-03 -3.92E-01 -5.32E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.22E-01 -1.69E-01 -3.37E-01
Lung cancer 2C25 Lung tissue 1.62E-23 -5.50E-01 -9.68E-01
Lupus erythematosus 4A40 Whole blood 5.69E-07 9.89E-02 5.99E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.90E-01 4.96E-02 1.81E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.04E-01 -6.17E-02 -3.33E-01
Melanoma 2C30 Skin 5.70E-02 -1.24E+00 -1.15E+00
Multiple myeloma 2A83.1 Bone marrow 8.46E-01 -1.12E-02 -9.21E-02
Multiple myeloma 2A83.1 Peripheral blood 6.00E-01 2.47E-02 3.17E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.21E-01 -1.71E-01 -8.44E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.70E-01 -1.42E-02 -1.26E-01
Myelofibrosis 2A20.2 Whole blood 6.38E-04 2.05E-01 1.51E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.00E-01 1.10E-01 2.41E-01
Myopathy 8C70.6 Muscle tissue 8.54E-01 -2.19E-01 -6.23E-01
Neonatal sepsis KA60 Whole blood 3.32E-01 1.95E-02 1.42E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.51E-01 -2.97E-01 -7.09E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 6.02E-01 -2.03E-02 -1.59E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.91E-03 -1.29E+00 -1.50E+00
Olive pollen allergy CA08.00 Peripheral blood 4.29E-01 3.16E-02 3.11E-01
Oral cancer 2B6E Oral tissue 7.00E-01 9.24E-02 2.47E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.94E-02 -8.33E-01 -1.35E+00
Osteoporosis FB83.1 Bone marrow 6.29E-01 3.92E-02 3.02E-01
Ovarian cancer 2C73 Ovarian tissue 1.72E-03 -1.90E+00 -1.59E+00
Pancreatic cancer 2C10 Pancreas 2.22E-02 -5.35E-01 -8.05E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.58E-01 -1.60E-01 -2.98E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.77E-01 -7.80E-04 -6.71E-03
Pituitary cancer 2D12 Pituitary tissue 4.86E-04 -4.76E-01 -1.45E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.54E-04 -7.59E-01 -2.43E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.89E-01 -3.08E-02 -2.17E-01
Polycythemia vera 2A20.4 Whole blood 3.13E-05 1.07E-01 7.81E-01
Pompe disease 5C51.3 Biceps muscle 1.19E-02 7.12E-01 2.07E+00
Preterm birth KA21.4Z Myometrium 4.93E-01 2.18E-02 2.99E-01
Prostate cancer 2C82 Prostate 1.74E-01 1.05E+00 8.58E-01
Psoriasis EA90 Skin 4.48E-03 3.58E-01 4.51E-01
Rectal cancer 2B92 Rectal colon tissue 2.02E-02 -2.39E-01 -1.62E+00
Renal cancer 2C90-2C91 Kidney 2.92E-06 7.69E-02 8.94E-01
Retinoblastoma 2D02.2 Uvea 1.96E-03 -3.49E-01 -1.57E+00
Rheumatoid arthritis FA20 Synovial tissue 5.86E-02 -3.62E-01 -9.76E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.66E-01 5.68E-04 5.21E-03
Schizophrenia 6A20 Prefrontal cortex 3.03E-01 -8.15E-02 -3.04E-01
Schizophrenia 6A20 Superior temporal cortex 3.53E-01 -1.19E-01 -7.69E-01
Scleroderma 4A42.Z Whole blood 4.83E-01 -4.13E-02 -3.34E-01
Seizure 8A60-8A6Z Whole blood 6.17E-02 -7.06E-02 -7.53E-01
Sensitive skin EK0Z Skin 5.05E-01 1.93E-01 4.28E-01
Sepsis with septic shock 1G41 Whole blood 6.45E-03 3.96E-02 2.59E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.75E-01 -2.97E-02 -2.33E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.18E-01 1.07E-02 4.64E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 5.87E-01 1.95E-01 7.05E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.56E-01 8.68E-02 4.72E-01
Skin cancer 2C30-2C3Z Skin 9.50E-20 -1.17E+00 -1.20E+00
Thrombocythemia 3B63 Whole blood 2.47E-02 5.59E-02 3.99E-01
Thrombocytopenia 3B64 Whole blood 2.22E-01 1.11E+00 1.88E+00
Thyroid cancer 2D10 Thyroid 7.17E-24 -4.77E-01 -1.34E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.33E-01 -1.50E-01 -2.07E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.35E-01 1.27E-01 1.78E+00
Type 2 diabetes 5A11 Liver tissue 7.02E-01 -1.28E-01 -2.90E-01
Ureter cancer 2C92 Urothelium 4.94E-01 2.01E-02 1.18E-01
Uterine cancer 2C78 Endometrium tissue 5.76E-01 1.20E-02 2.33E-02
Vitiligo ED63.0 Skin 7.82E-01 1.13E-01 1.53E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases