Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTEW95J)

DTP Name Long-chain fatty acid transport protein 3 (SLC27A3)
Gene Name SLC27A3
UniProt ID
Q5K4L6 (S27A3_HUMAN)
VARIDT ID
DTD0240
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ACSVL3; FATP-3; FATP3; PSEC0067; SLC27A3; Solute carrier family 27 member 3; UNQ367/PRO703; VLCS-3; Very long-chain acyl-CoA synthetase homolog 3; Solute carrier family 27 member 3
DTP Family Fatty Acid Transporter (FAT) Family ;
Sequence
MAALLLLPLLLLLPLLLLKLHLWPQLRWLPADLAFAVRALCCKRALRARALAAAAADPEG
PEGGCSLAWRLAELAQQRAAHTFLIHGSRRFSYSEAERESNRAARAFLRALGWDWGPDGG
DSGEGSAGEGERAAPGAGDAAAGSGAEFAGGDGAARGGGAAAPLSPGATVALLLPAGPEF
LWLWFGLAKAGLRTAFVPTALRRGPLLHCLRSCGARALVLAPEFLESLEPDLPALRAMGL
HLWAAGPGTHPAGISDLLAEVSAEVDGPVPGYLSSPQSITDTCLYIFTSGTTGLPKAARI
SHLKILQCQGFYQLCGVHQEDVIYLALPLYHMSGSLLGIVGCMGIGATVVLKSKFSAGQF
WEDCQQHRVTVFQYIGELCRYLVNQPPSKAERGHKVRLAVGSGLRPDTWERFVRRFGPLQ
VLETYGLTEGNVATINYTGQRGAVGRASWLYKHIFPFSLIRYDVTTGEPIRDPQGHCMAT
SPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLLKDVFRPGDVFFNTGDLLVCDDQGFLRF
HDRTGDTFRWKGENVATTEVAEVFEALDFLQEVNVYGVTVPGHEGRAGMAALVLRPPHAL
DLMQLYTHVSENLPPYARPRFLRLQESLATTETFKQQKVRMANEGFDPSTLSDPLYVLDQ
AVGAYLPLTTARYSALLAGNLRI
Function This transporter does not exhibit fatty acid transport activity. It has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.
Endogenous Substrate(s) Fatty acids
TCDB ID
4.C.1.1.12
Gene ID
11000
KEGG Pathway
Insulin resistance (hsa04931 )
Reactome Pathway
Synthesis of very long-chain fatty acyl-CoAs (R-HSA-75876 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.61E-03 -2.01E-01 -2.97E-01
Adrenocortical carcinoma 2D11.Z Kidney 5.84E-01 6.69E-02 1.40E-01
Alopecia ED70 Skin from scalp 2.39E-02 1.79E-01 5.97E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.61E-02 2.17E-01 5.07E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.54E-01 1.96E-03 1.01E-02
Aortic stenosis BB70 Calcified aortic valve 5.37E-01 -4.00E-01 -6.18E-01
Apnea 7A40 Hyperplastic tonsil 1.83E-01 -1.09E-01 -2.39E-01
Arthropathy FA00-FA5Z Peripheral blood 4.56E-01 -5.76E-02 -2.07E-01
Asthma CA23 Nasal and bronchial airway 4.79E-04 2.66E-01 3.83E-01
Atopic dermatitis EA80 Skin 1.85E-10 5.12E-01 2.48E+00
Autism 6A02 Whole blood 2.09E-01 8.59E-02 1.42E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.97E-01 2.67E-01 9.11E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.61E-01 -3.02E-01 -2.66E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.64E-02 -1.59E-01 -4.87E-01
Batten disease 5C56.1 Whole blood 8.02E-01 -9.73E-02 -2.99E-01
Behcet's disease 4A62 Peripheral blood 9.48E-01 -7.57E-02 -3.54E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.31E-01 5.28E-02 1.65E-01
Bladder cancer 2C94 Bladder tissue 2.86E-02 -2.55E-01 -9.67E-01
Breast cancer 2C60-2C6Z Breast tissue 4.79E-54 -7.26E-01 -1.40E+00
Cardioembolic stroke 8B11.20 Whole blood 6.60E-02 -1.46E-01 -5.23E-01
Cervical cancer 2C77 Cervical tissue 8.51E-01 -5.85E-02 -1.33E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.80E-01 -2.32E-02 -4.41E-02
Chronic hepatitis C 1E51.1 Whole blood 2.34E-01 -2.41E-01 -6.07E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.57E-02 -1.20E-01 -3.60E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.39E-01 -1.19E-02 -3.54E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.41E-01 -1.61E-02 -5.64E-02
Colon cancer 2B90 Colon tissue 4.48E-01 3.28E-02 6.90E-02
Coronary artery disease BA80-BA8Z Peripheral blood 4.88E-02 2.31E-01 1.05E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.16E-01 -3.63E-01 -8.63E-01
Endometriosis GA10 Endometrium tissue 1.27E-02 2.97E-01 6.53E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.35E-01 -1.57E-01 -4.84E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.02E-16 1.61E+00 2.04E+00
Gastric cancer 2B72 Gastric tissue 8.00E-01 3.88E-01 7.00E-01
Glioblastopma 2A00.00 Nervous tissue 1.42E-87 7.56E-01 1.44E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.35E-04 9.34E-01 2.02E+00
Head and neck cancer 2D42 Head and neck tissue 3.78E-10 3.26E-01 1.16E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.65E-02 1.36E-01 6.88E-01
Huntington's disease 8A01.10 Whole blood 9.61E-01 -1.55E-01 -2.75E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.73E-01 -5.55E-01 -9.89E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.56E-01 -1.58E-02 -7.42E-02
Influenza 1.00E+30 Whole blood 7.46E-02 6.56E-01 3.16E+00
Interstitial cystitis GC00.3 Bladder tissue 3.21E-01 5.30E-02 1.98E-01
Intracranial aneurysm 8B01.0 Intracranial artery 5.41E-03 -6.13E-01 -1.32E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.04E-01 -3.26E-01 -5.96E-01
Ischemic stroke 8B11 Peripheral blood 4.68E-02 -1.46E-01 -5.84E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.10E-08 -6.69E-01 -1.03E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 2.32E-01 2.14E-01 6.51E-01
Lateral sclerosis 8B60.4 Skin 6.79E-01 1.86E-02 6.81E-02
Liver cancer 2C12.0 Liver tissue 4.03E-01 -1.80E-01 -3.60E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.10E-04 -8.35E-01 -2.21E+00
Lung cancer 2C25 Lung tissue 4.83E-104 -1.31E+00 -3.02E+00
Lupus erythematosus 4A40 Whole blood 2.70E-08 6.57E-01 7.99E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.07E-01 -1.62E-02 -2.67E-02
Major depressive disorder 6A70-6A7Z Hippocampus 6.23E-01 -2.29E-02 -7.23E-02
Melanoma 2C30 Skin 3.88E-02 2.39E-01 4.51E-01
Multiple myeloma 2A83.1 Bone marrow 6.46E-04 3.85E-01 1.87E+00
Multiple myeloma 2A83.1 Peripheral blood 9.20E-01 -1.52E-03 -7.66E-03
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.22E-01 -1.25E-01 -3.17E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.93E-04 -3.89E-01 -7.12E-01
Myelofibrosis 2A20.2 Whole blood 8.84E-01 3.47E-02 1.31E-01
Myocardial infarction BA41-BA50 Peripheral blood 7.09E-01 6.12E-02 7.90E-02
Myopathy 8C70.6 Muscle tissue 5.41E-04 6.54E-01 1.65E+00
Neonatal sepsis KA60 Whole blood 7.95E-08 4.29E-01 9.29E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.14E-09 4.55E-01 2.81E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.68E-01 -1.89E-01 -2.37E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.15E-01 4.38E-01 1.05E+00
Olive pollen allergy CA08.00 Peripheral blood 6.26E-01 9.63E-02 1.28E-01
Oral cancer 2B6E Oral tissue 3.60E-03 2.84E-01 6.23E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.55E-01 6.49E-01 9.23E-01
Osteoporosis FB83.1 Bone marrow 7.85E-01 -1.07E-01 -2.47E-01
Ovarian cancer 2C73 Ovarian tissue 2.06E-01 1.23E-01 2.59E-01
Pancreatic cancer 2C10 Pancreas 3.95E-09 6.65E-01 2.30E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 3.99E-01 1.16E-01 5.81E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.78E-03 5.44E-01 9.62E-01
Pituitary cancer 2D12 Pituitary tissue 5.85E-01 3.05E-01 4.45E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.01E-01 3.89E-01 5.28E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.38E-01 7.42E-02 3.92E-01
Polycythemia vera 2A20.4 Whole blood 4.92E-01 -5.85E-02 -2.13E-01
Pompe disease 5C51.3 Biceps muscle 8.25E-02 3.98E-01 1.10E+00
Preterm birth KA21.4Z Myometrium 5.15E-01 9.73E-02 3.02E-01
Prostate cancer 2C82 Prostate 8.47E-04 -6.83E-01 -1.12E+00
Psoriasis EA90 Skin 1.67E-15 -4.66E-01 -1.21E+00
Rectal cancer 2B92 Rectal colon tissue 9.25E-02 -3.15E-01 -9.73E-01
Renal cancer 2C90-2C91 Kidney 3.34E-03 7.31E-01 1.53E+00
Retinoblastoma 2D02.2 Uvea 2.29E-07 1.95E+00 8.22E+00
Rheumatoid arthritis FA20 Synovial tissue 4.13E-06 1.59E+00 4.94E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.79E-01 -1.70E-02 -8.40E-02
Schizophrenia 6A20 Prefrontal cortex 3.74E-02 4.03E-01 3.08E-01
Schizophrenia 6A20 Superior temporal cortex 3.29E-02 1.47E-01 5.97E-01
Scleroderma 4A42.Z Whole blood 2.83E-01 1.74E-01 6.56E-01
Seizure 8A60-8A6Z Whole blood 6.45E-01 2.39E-01 2.44E-01
Sensitive skin EK0Z Skin 2.01E-01 6.63E-02 3.99E-01
Sepsis with septic shock 1G41 Whole blood 4.92E-09 3.40E-01 7.12E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.77E-02 -8.71E-02 -4.92E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.15E-01 -4.69E-02 -9.94E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 7.90E-01 1.07E-01 1.04E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.23E-02 6.83E-01 2.24E+00
Skin cancer 2C30-2C3Z Skin 4.61E-08 -4.83E-01 -1.19E+00
Thrombocythemia 3B63 Whole blood 4.30E-01 -1.17E-01 -4.40E-01
Thrombocytopenia 3B64 Whole blood 4.33E-01 3.89E-01 3.65E-01
Thyroid cancer 2D10 Thyroid 7.40E-02 9.06E-02 3.08E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.75E-07 1.08E+00 2.69E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.80E-01 2.74E-02 7.48E-02
Type 2 diabetes 5A11 Liver tissue 1.06E-01 -4.95E-01 -1.39E+00
Ureter cancer 2C92 Urothelium 7.65E-01 -1.03E-02 -5.79E-02
Uterine cancer 2C78 Endometrium tissue 1.79E-07 -3.05E-01 -4.21E-01
Vitiligo ED63.0 Skin 7.42E-01 1.47E-01 9.22E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases