Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTF6R81)

DTP Name Tumor suppressor candidate 3 (SLC58A2)
Gene Name SLC58A2
UniProt ID
Q13454 (TUSC3_HUMAN)
VARIDT ID
DTD0415
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms D8S1992; M33; MRT22; MRT7; MagT2; N33; OST3A; SLC58A2; TUSC3
DTP Family Magnesium Transporter1 (MAGT1) Family ;
Sequence
MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWS
SRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSS
AFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAK
WIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF
AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNE
AATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSDLDFE
Function
This transporter acts as accessory component of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Involved in N-glycosylation of STT3B-dependent substrates.
Endogenous Substrate(s) Mg2+
TCDB ID
1.A.76.1.2
Gene ID
7991
KEGG Pathway
N-Glycan biosynthesis (hsa00510 )
Various types of N-glycan biosynthesis (hsa00513 )
Metabolic pathways (hsa01100 )
Protein processing in endoplasmic reticulum (hsa04141 )
Reactome Pathway
Miscellaneous transport and binding events (R-HSA-5223345 )
Maturation of spike protein (R-HSA-9694548 )
Asparagine N-linked glycosylation (R-HSA-446203 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.84E-01 -9.39E-03 -7.31E-02
Adrenocortical carcinoma 2D11.Z Kidney 8.62E-01 -3.88E-02 -6.60E-02
Alopecia ED70 Skin from scalp 7.74E-01 -9.50E-03 -2.69E-02
Alzheimer's disease 8A20 Entorhinal cortex 3.99E-10 -7.14E-01 -9.36E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.14E-01 -7.60E-02 -8.23E-01
Aortic stenosis BB70 Calcified aortic valve 5.71E-01 1.09E-01 1.85E-01
Apnea 7A40 Hyperplastic tonsil 1.02E-01 -1.75E-01 -5.19E-01
Arthropathy FA00-FA5Z Peripheral blood 7.00E-01 3.74E-02 3.43E-01
Asthma CA23 Nasal and bronchial airway 5.94E-02 -1.91E-01 -2.75E-01
Atopic dermatitis EA80 Skin 1.71E-02 -2.65E-01 -7.38E-01
Autism 6A02 Whole blood 4.92E-01 6.63E-02 4.80E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.90E-01 -2.43E-02 -1.91E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.71E-01 -1.44E-01 -9.72E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.69E-06 2.59E-01 6.08E-01
Batten disease 5C56.1 Whole blood 1.58E-01 1.63E-01 1.48E+00
Behcet's disease 4A62 Peripheral blood 1.85E-01 9.25E-02 5.24E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.11E-01 -1.50E-01 -3.70E-01
Bladder cancer 2C94 Bladder tissue 8.79E-04 -1.86E+00 -2.38E+00
Breast cancer 2C60-2C6Z Breast tissue 4.80E-19 -7.23E-01 -9.03E-01
Cardioembolic stroke 8B11.20 Whole blood 7.39E-03 7.53E-02 7.14E-01
Cervical cancer 2C77 Cervical tissue 6.21E-03 5.09E-01 9.17E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.70E-03 7.03E-02 5.69E-01
Chronic hepatitis C 1E51.1 Whole blood 3.88E-01 -2.36E-02 -1.24E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.33E-01 -3.70E-02 -8.19E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.38E-01 1.77E-01 2.82E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.34E-01 -3.15E-02 -5.69E-02
Colon cancer 2B90 Colon tissue 4.65E-09 -2.49E-01 -4.90E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.06E-01 -3.27E-02 -5.63E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.49E-01 6.99E-03 5.79E-02
Endometriosis GA10 Endometrium tissue 8.13E-01 7.07E-02 6.00E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.71E-01 1.25E-02 1.37E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.34E-02 1.28E-01 9.70E-01
Gastric cancer 2B72 Gastric tissue 1.86E-02 2.24E-01 1.05E+00
Glioblastopma 2A00.00 Nervous tissue 4.98E-06 -4.99E-01 -4.52E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.19E-03 1.55E+00 1.87E+00
Head and neck cancer 2D42 Head and neck tissue 6.53E-07 -8.68E-02 -4.65E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.08E-02 -8.77E-01 -8.47E-01
Huntington's disease 8A01.10 Whole blood 4.41E-01 1.40E-02 1.90E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.95E-02 9.21E-01 1.68E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.77E-01 7.81E-02 7.28E-01
Influenza 1.00E+30 Whole blood 4.16E-02 1.02E-01 1.24E+00
Interstitial cystitis GC00.3 Bladder tissue 4.12E-06 -1.75E+00 -8.26E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.99E-04 1.29E+00 2.95E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.52E-03 -2.41E-01 -5.82E-01
Ischemic stroke 8B11 Peripheral blood 4.47E-01 9.49E-03 7.26E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 7.63E-01 2.41E-02 7.94E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 1.99E-01 -1.91E-01 -4.35E-01
Lateral sclerosis 8B60.4 Skin 2.06E-01 -6.26E-02 -2.05E-01
Liver cancer 2C12.0 Liver tissue 2.03E-01 -2.47E-01 -7.13E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.03E-01 3.04E-01 9.11E-01
Lung cancer 2C25 Lung tissue 3.26E-03 -3.12E-01 -4.59E-01
Lupus erythematosus 4A40 Whole blood 1.59E-02 4.83E-03 2.04E-02
Major depressive disorder 6A70-6A7Z Whole blood 4.40E-01 -1.55E-02 -1.00E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.83E-01 6.42E-02 1.91E-01
Melanoma 2C30 Skin 7.16E-01 1.01E-01 9.16E-02
Multiple myeloma 2A83.1 Bone marrow 7.53E-01 -2.62E-02 -2.87E-01
Multiple myeloma 2A83.1 Peripheral blood 7.70E-03 1.98E-01 2.11E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.70E-01 3.16E-03 2.22E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.29E-04 2.42E-02 2.01E-01
Myelofibrosis 2A20.2 Whole blood 5.38E-01 -3.65E-03 -2.82E-02
Myocardial infarction BA41-BA50 Peripheral blood 2.66E-03 1.77E-01 5.62E-01
Myopathy 8C70.6 Muscle tissue 3.96E-02 1.94E-01 9.70E-01
Neonatal sepsis KA60 Whole blood 8.09E-02 3.82E-02 2.17E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.36E-13 2.84E+00 7.37E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.56E-01 -6.04E-02 -4.12E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.56E-01 1.27E-01 1.12E+00
Olive pollen allergy CA08.00 Peripheral blood 1.77E-01 -8.38E-02 -1.16E+00
Oral cancer 2B6E Oral tissue 1.23E-03 1.67E-01 3.20E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.52E-02 1.45E+00 1.38E+00
Osteoporosis FB83.1 Bone marrow 2.54E-01 -2.87E-01 -5.10E-01
Ovarian cancer 2C73 Ovarian tissue 4.12E-02 -6.74E-01 -8.88E-01
Pancreatic cancer 2C10 Pancreas 4.30E-01 3.84E-02 3.70E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 8.53E-01 -5.61E-02 -1.40E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.13E-02 -1.49E-01 -9.96E-01
Pituitary cancer 2D12 Pituitary tissue 1.20E-02 3.51E-01 5.64E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.97E-04 6.57E-01 1.47E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.05E-01 -2.33E-03 -1.71E-02
Polycythemia vera 2A20.4 Whole blood 4.89E-01 -1.20E-02 -8.28E-02
Pompe disease 5C51.3 Biceps muscle 7.74E-02 2.77E-01 7.30E-01
Preterm birth KA21.4Z Myometrium 3.68E-02 6.17E-01 1.38E+00
Prostate cancer 2C82 Prostate 2.57E-04 1.59E+00 1.40E+00
Psoriasis EA90 Skin 2.12E-07 2.83E-01 6.74E-01
Rectal cancer 2B92 Rectal colon tissue 2.27E-01 -4.13E-01 -6.42E-01
Renal cancer 2C90-2C91 Kidney 9.97E-02 8.75E-01 7.87E-01
Retinoblastoma 2D02.2 Uvea 9.57E-06 -1.66E+00 -4.36E+00
Rheumatoid arthritis FA20 Synovial tissue 5.03E-06 4.66E-01 1.30E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.35E-01 2.46E-02 4.35E-02
Schizophrenia 6A20 Prefrontal cortex 1.00E-02 -9.75E-01 -7.60E-01
Schizophrenia 6A20 Superior temporal cortex 3.44E-01 1.74E-01 3.88E-01
Scleroderma 4A42.Z Whole blood 7.76E-01 -1.27E-02 -8.62E-02
Seizure 8A60-8A6Z Whole blood 5.44E-01 -4.54E-02 -3.38E-01
Sensitive skin EK0Z Skin 9.77E-01 -1.92E-01 -4.28E-01
Sepsis with septic shock 1G41 Whole blood 1.39E-07 6.84E-02 4.28E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.10E-01 8.56E-03 2.87E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.63E-01 1.31E-02 8.78E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 8.84E-01 -1.05E-01 -2.92E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.62E-03 2.88E-01 1.65E+01
Skin cancer 2C30-2C3Z Skin 7.68E-47 1.50E+00 2.32E+00
Thrombocythemia 3B63 Whole blood 6.87E-02 -7.66E-02 -5.15E-01
Thrombocytopenia 3B64 Whole blood 4.59E-01 6.43E-02 3.62E-01
Thyroid cancer 2D10 Thyroid 4.67E-80 2.85E+00 4.17E+00
Tibial muscular dystrophy 8C75 Muscle tissue 2.96E-10 1.23E+00 6.31E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.72E-02 -8.74E-01 -5.57E+00
Type 2 diabetes 5A11 Liver tissue 2.82E-01 6.36E-02 4.74E-01
Ureter cancer 2C92 Urothelium 4.23E-01 -5.08E-02 -2.59E-01
Uterine cancer 2C78 Endometrium tissue 3.65E-01 2.16E-01 2.75E-01
Vitiligo ED63.0 Skin 7.33E-01 3.11E-01 5.88E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases