General Information of Drug Transporter (DTP) (ID: DTF9Y2V)

DTP Name ATP-binding cassette sub-family B member 6 (ABCB6)
Gene Name ABCB6
UniProt ID
Q9NP58 (ABCB6_HUMAN)
VARIDT ID
DTD0052
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ABCB6; LAN; MTABC3; Mitochondrial ABC transporter 3; Mt-ABC transporter 3; P-glycoprotein-related protein; PRP; UMAT; Ubiquitously-expressed mammalian ABC half transporter
DTP Family ATP-Binding Cassette (ABC) Superfamily
Heavy Metal Transporter (HMT) Family (ABCB)
Tissue Specificity Widely expressed. High expression is detectedin the retinal epithelium.
Sequence
MVTVGNYCEAEGPVGPAWMQDGLSPCFFFTLVPSTRMALGTLALVLALPCRRRERPAGAD
SLSWGAGPRISPYVLQLLLATLQAALPLAGLAGRVGTARGAPLPSYLLLASVLESLAGAC
GLWLLVVERSQARQRLAMGIWIKFRHSPGLLLLWTVAFAAENLALVSWNSPQWWWARADL
GQQVQFSLWVLRYVVSGGLFVLGLWAPGLRPQSYTLQVHEEDQDVERSQVRSAAQQSTWR
DFGRKLRLLSGYLWPRGSPALQLVVLICLGLMGLERALNVLVPIFYRNIVNLLTEKAPWN
SLAWTVTSYVFLKFLQGGGTGSTGFVSNLRTFLWIRVQQFTSRRVELLIFSHLHELSLRW
HLGRRTGEVLRIADRGTSSVTGLLSYLVFNVIPTLADIIIGIIYFSMFFNAWFGLIVFLC
MSLYLTLTIVVTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAESYEVERYREAI
IKYQGLEWKSSASLVLLNQTQNLVIGLGLLAGSLLCAYFVTEQKLQVGDYVLFGTYIIQL
YMPLNWFGTYYRMIQTNFIDMENMFDLLKEETEVKDLPGAGPLRFQKGRIEFENVHFSYA
DGRETLQDVSFTVMPGQTLALVGPSGAGKSTILRLLFRFYDISSGCIRIDGQDISQVTQA
SLRSHIGVVPQDTVLFNDTIADNIRYGRVTAGNDEVEAAAQAAGIHDAIMAFPEGYRTQV
GERGLKLSGGEKQRVAIARTILKAPGIILLDEATSALDTSNERAIQASLAKVCANRTTIV
VAHRLSTVVNADQILVIKDGCIVERGRHEALLSRGGVYADMWQLQQGQEETSEDTKPQTM
ER
Function This transporter plays a crucial role in heme synthesis. Binds heme and porphyrins and functions in their ATP-dependent uptake into the mitochondria.
Endogenous Substrate(s) Anionic porphyrins; Porphyrins
TCDB ID
3.A.1.210.6
Gene ID
10058
KEGG Pathway
ABC transporters (hsa02010 )
Reactome Pathway
Defective ABCB6 causes MCOPCB7 (R-HSA-5683371 )
Mitochondrial ABC transporters (R-HSA-1369007 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Verteporfin DMIY6DB Choroidal neovascularization 9B76 Approved [1]
------------------------------------------------------------------------------------
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Tomatine DMA3U15 N. A. N. A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.27E-19 -5.46E-01 -1.32E+00
Adrenocortical carcinoma 2D11.Z Kidney 2.15E-02 1.16E-01 6.65E-01
Alopecia ED70 Skin from scalp 1.27E-04 -1.95E-01 -6.41E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.01E-01 -3.67E-02 -2.58E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.36E-01 -2.39E-02 -1.85E-01
Aortic stenosis BB70 Calcified aortic valve 2.27E-01 -1.22E-01 -5.47E-01
Apnea 7A40 Hyperplastic tonsil 1.84E-01 -1.36E-01 -5.88E-01
Arthropathy FA00-FA5Z Peripheral blood 5.42E-01 -6.18E-02 -3.03E-01
Asthma CA23 Nasal and bronchial airway 5.83E-01 5.44E-02 1.76E-01
Atopic dermatitis EA80 Skin 7.15E-05 2.02E-01 1.28E+00
Autism 6A02 Whole blood 1.82E-01 -1.22E-01 -5.82E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.22E-03 -3.37E-01 -2.18E+00
Autosomal dominant monocytopenia 4B04 Whole blood 6.88E-01 1.90E-02 1.86E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.07E-01 7.38E-02 2.56E-01
Batten disease 5C56.1 Whole blood 5.58E-01 1.12E-01 7.58E-01
Behcet's disease 4A62 Peripheral blood 2.26E-01 1.11E-01 4.41E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.51E-01 -3.13E-02 -2.30E-01
Bladder cancer 2C94 Bladder tissue 2.00E-01 -1.30E-01 -7.59E-01
Breast cancer 2C60-2C6Z Breast tissue 5.43E-02 -6.40E-02 -1.75E-01
Cardioembolic stroke 8B11.20 Whole blood 9.93E-01 -4.12E-03 -2.51E-02
Cervical cancer 2C77 Cervical tissue 4.98E-01 -7.09E-02 -2.65E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.18E-01 1.95E-02 8.01E-02
Chronic hepatitis C 1E51.1 Whole blood 2.67E-01 1.05E-01 5.64E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.01E-01 -1.34E-01 -4.37E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.81E-05 3.04E-01 7.26E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.72E-01 -2.13E-01 -9.32E-01
Colon cancer 2B90 Colon tissue 3.20E-17 2.35E-01 8.00E-01
Coronary artery disease BA80-BA8Z Peripheral blood 8.88E-02 1.12E-01 2.40E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.20E-01 -6.44E-02 -3.05E-01
Endometriosis GA10 Endometrium tissue 2.19E-01 2.37E-02 6.21E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.29E-01 6.08E-02 3.77E-01
Familial hypercholesterolemia 5C80.00 Whole blood 9.56E-01 2.81E-02 9.55E-02
Gastric cancer 2B72 Gastric tissue 1.38E-01 1.58E-01 1.31E+00
Glioblastopma 2A00.00 Nervous tissue 5.65E-01 6.64E-03 2.83E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.57E-01 5.39E-03 1.57E-02
Head and neck cancer 2D42 Head and neck tissue 7.73E-02 -6.88E-02 -2.41E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.53E-01 -6.77E-02 -2.63E-01
Huntington's disease 8A01.10 Whole blood 1.82E-01 1.56E-01 8.64E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.31E-01 -2.28E-01 -1.14E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.81E-01 3.24E-02 2.48E-01
Influenza 1.00E+30 Whole blood 1.47E-01 1.30E-01 9.47E-01
Interstitial cystitis GC00.3 Bladder tissue 7.40E-04 -3.71E-01 -3.00E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.65E-01 1.41E-01 4.23E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.54E-01 -2.65E-02 -1.10E-01
Ischemic stroke 8B11 Peripheral blood 2.93E-01 1.08E-01 4.20E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.02E-01 -5.53E-03 -1.55E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 6.01E-01 7.89E-02 3.04E-01
Lateral sclerosis 8B60.4 Skin 6.54E-01 -1.02E-01 -3.20E-01
Liver cancer 2C12.0 Liver tissue 4.88E-01 4.06E-02 1.45E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.05E-01 -6.73E-02 -1.81E-01
Lung cancer 2C25 Lung tissue 3.53E-53 4.71E-01 1.80E+00
Lupus erythematosus 4A40 Whole blood 7.76E-01 -8.91E-03 -2.52E-02
Major depressive disorder 6A70-6A7Z Whole blood 3.78E-01 -1.10E-02 -4.97E-02
Major depressive disorder 6A70-6A7Z Hippocampus 5.19E-01 1.74E-03 1.33E-02
Melanoma 2C30 Skin 2.32E-01 -1.61E-01 -3.94E-01
Multiple myeloma 2A83.1 Bone marrow 7.55E-02 1.72E-01 8.35E-01
Multiple myeloma 2A83.1 Peripheral blood 9.22E-01 -3.35E-02 -7.81E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.60E-01 2.24E-01 8.04E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.51E-02 3.09E-02 1.28E-01
Myelofibrosis 2A20.2 Whole blood 8.67E-03 4.13E-01 2.51E+00
Myocardial infarction BA41-BA50 Peripheral blood 6.55E-02 7.87E-02 2.97E-01
Myopathy 8C70.6 Muscle tissue 6.85E-02 -3.29E-01 -1.39E+00
Neonatal sepsis KA60 Whole blood 9.35E-01 -7.38E-02 -2.31E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.41E-09 4.61E-01 3.83E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.38E-02 -3.81E-01 -1.37E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.82E-01 -2.92E-03 -1.83E-02
Olive pollen allergy CA08.00 Peripheral blood 2.14E-01 1.81E-01 5.51E-01
Oral cancer 2B6E Oral tissue 8.72E-06 -4.50E-01 -9.60E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.55E-01 -4.10E-01 -7.74E-01
Osteoporosis FB83.1 Bone marrow 5.38E-01 9.57E-02 6.42E-01
Ovarian cancer 2C73 Ovarian tissue 8.68E-02 -2.32E-01 -7.27E-01
Pancreatic cancer 2C10 Pancreas 7.87E-01 2.72E-04 1.09E-03
Parkinson's disease 8A00.0 Substantia nigra tissue 8.88E-02 1.85E-01 8.15E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.32E-01 -1.03E-01 -5.65E-01
Pituitary cancer 2D12 Pituitary tissue 1.15E-01 1.14E-01 3.99E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.06E-01 -5.07E-02 -1.52E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.76E-01 -2.44E-02 -6.43E-02
Polycythemia vera 2A20.4 Whole blood 3.13E-08 2.00E-01 1.15E+00
Pompe disease 5C51.3 Biceps muscle 3.52E-02 1.87E-01 1.64E+00
Preterm birth KA21.4Z Myometrium 5.28E-01 -2.14E-01 -5.86E-01
Prostate cancer 2C82 Prostate 4.25E-05 5.43E-01 1.13E+00
Psoriasis EA90 Skin 4.39E-35 5.22E-01 2.09E+00
Rectal cancer 2B92 Rectal colon tissue 3.97E-02 2.82E-01 8.99E-01
Renal cancer 2C90-2C91 Kidney 3.13E-02 1.87E-01 6.30E-01
Retinoblastoma 2D02.2 Uvea 2.89E-01 -8.12E-02 -6.16E-01
Rheumatoid arthritis FA20 Synovial tissue 3.86E-01 -5.04E-01 -7.98E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.58E-02 -4.63E-02 -3.68E-01
Schizophrenia 6A20 Prefrontal cortex 6.83E-01 -2.67E-02 -8.84E-02
Schizophrenia 6A20 Superior temporal cortex 6.70E-01 -5.60E-02 -4.26E-01
Scleroderma 4A42.Z Whole blood 6.82E-03 -2.40E-01 -1.43E+00
Seizure 8A60-8A6Z Whole blood 9.71E-01 9.14E-03 5.23E-02
Sensitive skin EK0Z Skin 4.49E-01 7.96E-02 3.88E-01
Sepsis with septic shock 1G41 Whole blood 9.81E-01 -7.52E-02 -2.19E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.92E-01 -7.59E-02 -5.07E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.49E-03 1.67E-01 6.59E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.45E-01 5.73E-01 1.67E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.21E-01 6.33E-02 7.92E-01
Skin cancer 2C30-2C3Z Skin 2.37E-38 4.39E-01 1.44E+00
Thrombocythemia 3B63 Whole blood 4.86E-03 2.43E-02 1.42E-01
Thrombocytopenia 3B64 Whole blood 6.82E-01 2.09E-01 3.29E-01
Thyroid cancer 2D10 Thyroid 6.28E-19 -3.38E-01 -1.61E+00
Tibial muscular dystrophy 8C75 Muscle tissue 4.37E-06 -5.64E-01 -2.60E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.77E-01 -1.33E-02 -8.99E-02
Type 2 diabetes 5A11 Liver tissue 6.76E-01 -1.02E-01 -4.74E-01
Ureter cancer 2C92 Urothelium 8.18E-02 1.24E-01 6.35E-01
Uterine cancer 2C78 Endometrium tissue 1.22E-06 1.73E-01 5.14E-01
Vitiligo ED63.0 Skin 3.02E-01 -1.17E-01 -7.55E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Efficient purification and reconstitution of ATP binding cassette transporter B6 (ABCB6) for functional and structural studies. J Biol Chem. 2013 Aug 2;288(31):22658-69.