Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTGLZO4)

DTP Name ATP-binding cassette sub-family D member 3 (ABCD3)
Gene Name ABCD3
UniProt ID
P28288 (ABCD3_HUMAN)
VARIDT ID
DTD0065
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ABC43; ABCD3; ATP-binding cassette sub-family D member 3; CBAS5; PMP70; PXMP1; ZWS2; 70 kDa peroxisomal membrane protein
DTP Family ATP-Binding Cassette (ABC) Superfamily ;
Sequence
MAAFSKYLTARNSSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVD
KVFFSRLIQILKIMVPRTFCKETGYLVLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSRK
DFKRYLLNFIAAMPLISLVNNFLKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDN
RIANPDQLLTQDVEKFCNSVVDLYSNLSKPFLDIVLYIFKLTSAIGAQGPASMMAYLVVS
GLFLTRLRRPIGKMTITEQKYEGEYRYVNSRLITNSEEIAFYNGNKREKQTVHSVFRKLV
EHLHNFILFRFSMGFIDSIIAKYLATVVGYLVVSRPFLDLSHPRHLKSTHSELLEDYYQS
GRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQEKGIEG
VQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGPNGCGKS
SLFRVLGELWPLFGGRLTKPERGKLFYVPQRPYMTLGTLRDQVIYPDGREDQKRKGISDL
VLKEYLDNVQLGHILEREGGWDSVQDWMDVLSGGEKQRMAMARLFYHKPQFAILDECTSA
VSVDVEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS
Function This protein is probable transporter involved in the transport of branched-chain fatty acids and C27 bile acids into the peroxisome.
Endogenous Substrate(s) Long-chain fatty acids
TCDB ID
3.A.1.203.1
Gene ID
5825
KEGG Pathway
ABC transporters (hsa02010 )
Peroxisome (hsa04146 )
Reactome Pathway
RHOA GTPase cycle (R-HSA-8980692 )
RHOC GTPase cycle (R-HSA-9013106 )
Class I peroxisomal membrane protein import (R-HSA-9603798 )
ABC transporters in lipid homeostasis (R-HSA-1369062 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.42E-01 -1.80E-02 -4.21E-02
Adrenocortical carcinoma 2D11.Z Kidney 5.51E-03 4.27E-01 8.37E-01
Alopecia ED70 Skin from scalp 4.72E-02 1.58E-01 5.46E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.41E-01 -9.25E-02 -3.12E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.72E-01 -1.67E-02 -4.39E-02
Aortic stenosis BB70 Calcified aortic valve 9.93E-01 8.45E-02 9.46E-02
Apnea 7A40 Hyperplastic tonsil 5.68E-01 4.38E-01 9.46E-01
Arthropathy FA00-FA5Z Peripheral blood 3.42E-01 -1.58E-01 -4.43E-01
Asthma CA23 Nasal and bronchial airway 9.64E-02 -3.89E-01 -3.65E-01
Atopic dermatitis EA80 Skin 1.04E-02 -2.44E-01 -6.03E-01
Autism 6A02 Whole blood 2.52E-01 7.60E-02 2.22E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.09E-01 1.98E-02 7.07E-02
Autosomal dominant monocytopenia 4B04 Whole blood 1.68E-02 7.92E-01 1.71E+00
Bacterial infection of gingival 1C1H Gingival tissue 6.27E-10 -4.22E-01 -9.54E-01
Batten disease 5C56.1 Whole blood 8.72E-01 -1.20E-02 -5.45E-02
Behcet's disease 4A62 Peripheral blood 5.48E-01 -7.19E-02 -3.33E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.74E-01 5.94E-02 1.96E-01
Bladder cancer 2C94 Bladder tissue 3.51E-10 -1.23E+00 -5.73E+00
Breast cancer 2C60-2C6Z Breast tissue 1.89E-55 6.83E-01 1.36E+00
Cardioembolic stroke 8B11.20 Whole blood 1.91E-01 -2.65E-02 -9.98E-02
Cervical cancer 2C77 Cervical tissue 2.36E-01 -1.86E-01 -4.66E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.83E-01 -6.28E-02 -5.82E-02
Chronic hepatitis C 1E51.1 Whole blood 8.13E-01 -5.53E-02 -3.79E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.79E-01 -1.14E-01 -2.78E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.65E-05 -3.79E-01 -8.31E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.78E-01 -4.69E-01 -8.21E-01
Colon cancer 2B90 Colon tissue 1.23E-45 -1.20E+00 -1.70E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.30E-01 -2.75E-01 -1.39E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.67E-01 5.42E-02 6.01E-02
Endometriosis GA10 Endometrium tissue 1.78E-01 -1.87E-01 -4.13E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.54E-01 -9.23E-02 -3.16E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.19E-04 8.77E-01 1.32E+00
Gastric cancer 2B72 Gastric tissue 9.66E-01 -2.46E-01 -1.87E-01
Glioblastopma 2A00.00 Nervous tissue 9.78E-42 4.02E-01 8.01E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.38E-02 6.30E-01 1.16E+00
Head and neck cancer 2D42 Head and neck tissue 1.20E-29 -1.35E+00 -2.07E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.76E-01 7.66E-02 3.02E-01
Huntington's disease 8A01.10 Whole blood 5.99E-01 -1.03E-01 -3.98E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.88E-01 3.67E-02 8.60E-02
Immunodeficiency 4A00-4A20 Peripheral blood 6.36E-02 -2.46E-01 -1.44E+00
Influenza 1.00E+30 Whole blood 8.60E-02 -9.85E-01 -2.03E+00
Interstitial cystitis GC00.3 Bladder tissue 1.27E-03 -7.02E-01 -2.48E+00
Intracranial aneurysm 8B01.0 Intracranial artery 1.18E-01 -2.39E-01 -4.35E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.09E-01 -3.71E-02 -1.43E-01
Ischemic stroke 8B11 Peripheral blood 1.57E-01 -8.21E-02 -3.50E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.23E-02 1.72E-01 2.77E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.76E-02 -1.39E-01 -5.23E-01
Lateral sclerosis 8B60.4 Skin 6.75E-01 1.39E-01 6.95E-01
Liver cancer 2C12.0 Liver tissue 6.74E-02 -2.35E-01 -2.45E-01
Liver failure DB99.7-DB99.8 Liver tissue 5.81E-02 -7.27E-01 -1.59E+00
Lung cancer 2C25 Lung tissue 2.56E-09 -2.98E-01 -5.53E-01
Lupus erythematosus 4A40 Whole blood 7.62E-05 3.59E-01 6.25E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.62E-01 6.03E-02 1.38E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.80E-01 -3.08E-02 -9.67E-02
Melanoma 2C30 Skin 5.26E-02 -3.60E-01 -5.76E-01
Multiple myeloma 2A83.1 Bone marrow 1.03E-03 3.49E-01 1.70E+00
Multiple myeloma 2A83.1 Peripheral blood 7.30E-02 -2.62E-01 -1.98E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.20E-01 6.59E-02 1.84E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.08E-04 -2.21E-01 -4.75E-01
Myelofibrosis 2A20.2 Whole blood 9.35E-01 1.82E-02 7.46E-02
Myocardial infarction BA41-BA50 Peripheral blood 3.35E-01 2.35E-02 2.99E-02
Myopathy 8C70.6 Muscle tissue 2.96E-01 9.59E-02 1.98E-01
Neonatal sepsis KA60 Whole blood 7.72E-05 2.89E-01 4.84E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.41E-01 2.39E-01 3.95E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 2.59E-02 6.65E-01 9.54E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.03E-01 -2.21E-01 -5.80E-01
Olive pollen allergy CA08.00 Peripheral blood 5.81E-01 -3.78E-02 -3.71E-01
Oral cancer 2B6E Oral tissue 2.09E-02 4.18E-01 5.46E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.73E-01 1.21E-01 5.75E-01
Osteoporosis FB83.1 Bone marrow 1.22E-01 -3.29E-01 -1.70E+00
Ovarian cancer 2C73 Ovarian tissue 9.46E-02 4.29E-01 5.86E-01
Pancreatic cancer 2C10 Pancreas 9.72E-05 5.21E-01 1.43E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 4.08E-03 -3.99E-01 -1.19E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.96E-01 1.33E-02 8.37E-02
Pituitary cancer 2D12 Pituitary tissue 3.58E-01 1.40E-01 2.88E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.02E-01 3.42E-01 9.01E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.98E-01 -6.57E-02 -2.66E-01
Polycythemia vera 2A20.4 Whole blood 3.91E-05 -2.47E-01 -8.99E-01
Pompe disease 5C51.3 Biceps muscle 4.24E-01 -1.01E-01 -6.99E-01
Preterm birth KA21.4Z Myometrium 6.31E-01 9.93E-02 1.21E-01
Prostate cancer 2C82 Prostate 6.04E-01 5.11E-01 5.27E-01
Psoriasis EA90 Skin 1.82E-01 -4.23E-02 -7.37E-02
Rectal cancer 2B92 Rectal colon tissue 8.78E-05 -5.95E-01 -2.56E+00
Renal cancer 2C90-2C91 Kidney 4.27E-01 -4.18E-01 -4.88E-01
Retinoblastoma 2D02.2 Uvea 4.84E-04 -7.95E-01 -2.54E+00
Rheumatoid arthritis FA20 Synovial tissue 6.50E-03 2.54E-01 1.08E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.23E-02 -5.99E-02 -2.62E-01
Schizophrenia 6A20 Prefrontal cortex 6.58E-01 2.16E-02 4.25E-02
Schizophrenia 6A20 Superior temporal cortex 9.95E-01 -6.83E-02 -3.65E-01
Scleroderma 4A42.Z Whole blood 2.73E-05 -3.68E-01 -2.13E+00
Seizure 8A60-8A6Z Whole blood 8.28E-01 -1.02E-01 -1.83E-01
Sensitive skin EK0Z Skin 3.02E-01 2.47E-01 1.47E+00
Sepsis with septic shock 1G41 Whole blood 1.39E-01 -6.51E-02 -1.61E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.80E-01 5.33E-02 1.03E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.96E-03 -7.76E-01 -2.23E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 5.60E-01 -1.29E-01 -3.02E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.19E-01 5.82E-02 2.60E-01
Skin cancer 2C30-2C3Z Skin 8.89E-35 -8.19E-01 -1.36E+00
Thrombocythemia 3B63 Whole blood 1.86E-02 -2.48E-01 -1.01E+00
Thrombocytopenia 3B64 Whole blood 4.53E-01 -1.67E-01 -3.47E-01
Thyroid cancer 2D10 Thyroid 6.64E-03 -1.97E-01 -3.23E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.46E-01 2.28E-01 5.14E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.26E-02 -5.39E-01 -1.45E+00
Type 2 diabetes 5A11 Liver tissue 5.47E-01 -2.99E-02 -2.66E-01
Ureter cancer 2C92 Urothelium 6.55E-02 1.40E-01 3.29E-01
Uterine cancer 2C78 Endometrium tissue 3.28E-10 3.17E-01 5.68E-01
Vitiligo ED63.0 Skin 3.40E-02 4.04E-01 1.39E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases