Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTH1GEL)

DTP Name Sodium-dependent proline transporter (SLC6A7)
Gene Name SLC6A7
UniProt ID
Q99884 (SC6A7_HUMAN)
VARIDT ID
DTD0459
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms PROT; SLC6A7; Solute carrier family 6 member 7
DTP Family Neurotransmitter:Sodium Symporter (NSS) Family ;
Tissue Specificity Brain.
Sequence
MKKLQGAHLRKPVTPDLLMTPSDQGDVDLDVDFAAHRGNWTGKLDFLLSCIGYCVGLGNV
WRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGA
AMLLIVGLVAIYYNMIIAYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALP
LNLTCTVSPSEEYWSRYVLHIQGSQGIGSPGEIRWNLCLCLLLAWVIVFLCILKGVKSSG
KVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLG
VGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVA
KAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLR
PKKAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQ
RFCRDIHMMLGFKPGLYFRACWLFLSPATLLALMVYSIVKYQPSEYGSYRFPPWAELLGI
LMGLLSCLMIPAGMLVAVLREEGSLWERLQQASRPAMDWGPSLEENRTGMYVATLAGSQS
PKPLMVHMRKYGGITSFENTAIEVDREIAEEEESMM
Function This transporter terminates the action of proline by its high affinity sodium-dependent reuptake into presynaptic terminals.
Endogenous Substrate(s) Na+
TCDB ID
2.A.22.2.11
Gene ID
6534
KEGG Pathway
Synaptic vesicle cycle (hsa04721 )
Reactome Pathway
Creatine metabolism (R-HSA-71288 )
Na+/Cl- dependent neurotransmitter transporters (R-HSA-442660 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-Proline DMKSTWR Malnutrition 5B50-5B71 Approved [3]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.14E-01 -6.75E-02 -2.79E-01
Adrenocortical carcinoma 2D11.Z Kidney 7.36E-01 2.09E-03 9.11E-03
Alopecia ED70 Skin from scalp 6.64E-02 -6.11E-02 -2.65E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.15E-08 -4.43E-01 -8.09E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.49E-02 2.13E-01 7.68E-01
Aortic stenosis BB70 Calcified aortic valve 7.05E-01 -1.15E-02 -3.61E-02
Apnea 7A40 Hyperplastic tonsil 1.61E-01 9.70E-03 7.48E-02
Arthropathy FA00-FA5Z Peripheral blood 4.66E-02 6.32E-02 3.84E-01
Asthma CA23 Nasal and bronchial airway 8.01E-02 -7.93E-02 -2.27E-01
Atopic dermatitis EA80 Skin 5.07E-05 -1.33E-01 -8.50E-01
Autism 6A02 Whole blood 7.84E-01 -2.98E-02 -1.12E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.15E-02 -2.73E-01 -1.60E+00
Autosomal dominant monocytopenia 4B04 Whole blood 7.00E-01 -4.08E-02 -2.03E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.68E-03 8.84E-02 4.47E-01
Batten disease 5C56.1 Whole blood 1.03E-02 1.74E-01 1.49E+00
Behcet's disease 4A62 Peripheral blood 5.23E-01 -6.06E-03 -3.27E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.44E-01 -1.00E-02 -5.83E-02
Bladder cancer 2C94 Bladder tissue 6.43E-01 -2.90E-04 -1.42E-03
Breast cancer 2C60-2C6Z Breast tissue 3.01E-33 2.02E-01 9.22E-01
Cardioembolic stroke 8B11.20 Whole blood 2.15E-02 5.99E-02 3.48E-01
Cervical cancer 2C77 Cervical tissue 3.40E-03 -7.17E-02 -4.86E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.67E-01 2.88E-02 1.03E-01
Chronic hepatitis C 1E51.1 Whole blood 6.17E-01 1.79E-02 1.29E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.28E-01 -3.33E-02 -1.49E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.24E-02 9.97E-02 4.83E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.93E-01 -6.17E-02 -7.36E-01
Colon cancer 2B90 Colon tissue 2.65E-09 -1.61E-01 -6.90E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.55E-02 1.56E-01 8.32E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.19E-01 2.00E-02 8.41E-02
Endometriosis GA10 Endometrium tissue 6.10E-01 3.65E-02 1.21E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.67E-01 -3.86E-02 -2.08E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.29E-02 -1.83E-01 -6.28E-01
Gastric cancer 2B72 Gastric tissue 9.80E-03 2.80E-01 5.18E+00
Glioblastopma 2A00.00 Nervous tissue 1.11E-54 -4.46E-01 -8.74E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.46E-02 -5.66E-01 -1.43E+00
Head and neck cancer 2D42 Head and neck tissue 8.09E-02 4.35E-02 2.28E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.81E-02 -6.59E-02 -2.22E-01
Huntington's disease 8A01.10 Whole blood 3.42E-01 1.06E-01 6.64E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.08E-01 9.76E-02 3.55E-01
Immunodeficiency 4A00-4A20 Peripheral blood 6.93E-01 2.36E-02 1.99E-01
Influenza 1.00E+30 Whole blood 2.80E-01 2.85E-01 1.35E+00
Interstitial cystitis GC00.3 Bladder tissue 1.95E-01 1.19E-01 6.96E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.25E-01 8.76E-02 3.32E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.18E-01 -1.00E-02 -3.92E-02
Ischemic stroke 8B11 Peripheral blood 9.94E-02 5.90E-02 3.19E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.08E-02 5.66E-02 1.85E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.97E-02 3.57E-01 1.07E+00
Lateral sclerosis 8B60.4 Skin 2.67E-02 -2.47E-01 -2.23E+00
Liver cancer 2C12.0 Liver tissue 9.03E-08 -1.87E-01 -9.26E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.94E-03 -1.42E-01 -1.09E+00
Lung cancer 2C25 Lung tissue 5.11E-01 3.25E-02 1.52E-01
Lupus erythematosus 4A40 Whole blood 3.28E-01 -8.51E-02 -1.78E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.27E-01 3.76E-02 1.55E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.10E-02 7.92E-02 4.51E-01
Melanoma 2C30 Skin 9.03E-01 5.94E-02 1.41E-01
Multiple myeloma 2A83.1 Bone marrow 3.04E-02 9.65E-02 5.78E-01
Multiple myeloma 2A83.1 Peripheral blood 1.36E-01 -9.62E-02 -5.08E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.41E-01 1.31E-01 4.09E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.33E-01 -3.05E-02 -1.54E-01
Myelofibrosis 2A20.2 Whole blood 2.17E-01 -7.70E-04 -3.83E-03
Myocardial infarction BA41-BA50 Peripheral blood 1.03E-01 4.07E-01 7.08E-01
Myopathy 8C70.6 Muscle tissue 4.63E-01 -5.01E-02 -2.61E-01
Neonatal sepsis KA60 Whole blood 6.99E-04 -1.53E-01 -4.25E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.68E-01 9.35E-03 2.42E-02
Non-alcoholic fatty liver disease DB92 Liver tissue 2.16E-01 -7.38E-02 -4.14E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.32E-01 2.59E-02 1.96E-01
Olive pollen allergy CA08.00 Peripheral blood 9.63E-02 1.56E-02 2.35E-01
Oral cancer 2B6E Oral tissue 3.32E-03 -1.84E-01 -6.75E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.62E-01 -3.45E-03 -1.08E-02
Osteoporosis FB83.1 Bone marrow 2.71E-01 1.16E-01 6.19E-01
Ovarian cancer 2C73 Ovarian tissue 3.09E-01 -2.32E-01 -5.30E-01
Pancreatic cancer 2C10 Pancreas 4.18E-03 -2.75E-01 -8.24E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.86E-01 -8.37E-03 -6.35E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 7.36E-02 6.56E-02 5.76E-01
Pituitary cancer 2D12 Pituitary tissue 9.50E-03 2.02E-01 1.08E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.50E-02 9.40E-02 6.56E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.70E-02 6.89E-02 7.09E-01
Polycythemia vera 2A20.4 Whole blood 3.89E-01 6.17E-02 3.29E-01
Pompe disease 5C51.3 Biceps muscle 5.97E-02 -9.12E-02 -4.27E-01
Preterm birth KA21.4Z Myometrium 5.82E-01 1.39E-02 1.51E-01
Prostate cancer 2C82 Prostate 2.92E-01 -2.25E-01 -5.24E-01
Psoriasis EA90 Skin 8.52E-02 -4.17E-02 -8.92E-02
Rectal cancer 2B92 Rectal colon tissue 5.92E-01 -1.21E-01 -5.16E-01
Renal cancer 2C90-2C91 Kidney 7.19E-01 -1.47E-02 -6.44E-02
Retinoblastoma 2D02.2 Uvea 3.42E-01 -8.90E-02 -7.35E-01
Rheumatoid arthritis FA20 Synovial tissue 1.24E-01 -7.64E-02 -2.38E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.42E-01 -5.16E-03 -3.25E-02
Schizophrenia 6A20 Prefrontal cortex 4.34E-01 -9.89E-03 -2.78E-02
Schizophrenia 6A20 Superior temporal cortex 6.72E-01 2.86E-03 1.57E-02
Scleroderma 4A42.Z Whole blood 5.86E-01 6.09E-03 5.43E-02
Seizure 8A60-8A6Z Whole blood 3.16E-01 -3.37E-02 -1.11E-01
Sensitive skin EK0Z Skin 5.41E-01 4.09E-03 2.54E-02
Sepsis with septic shock 1G41 Whole blood 8.79E-03 -5.95E-02 -1.87E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.29E-03 3.56E-01 2.18E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.29E-02 1.10E-01 4.70E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.56E-01 3.14E-02 3.34E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.63E-01 -5.59E-01 -1.24E+00
Skin cancer 2C30-2C3Z Skin 1.71E-06 -1.98E-01 -4.02E-01
Thrombocythemia 3B63 Whole blood 7.14E-01 5.77E-03 3.07E-02
Thrombocytopenia 3B64 Whole blood 1.15E-01 -1.65E-01 -8.02E-01
Thyroid cancer 2D10 Thyroid 1.44E-04 7.01E-02 3.10E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.20E-03 -2.46E-01 -9.76E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.07E-01 -1.84E-01 -8.63E-01
Type 2 diabetes 5A11 Liver tissue 3.03E-01 -1.54E-01 -4.75E-01
Ureter cancer 2C92 Urothelium 4.71E-01 -8.61E-02 -3.16E-01
Uterine cancer 2C78 Endometrium tissue 1.98E-02 -5.76E-02 -2.18E-01
Vitiligo ED63.0 Skin 2.89E-01 -5.67E-02 -3.91E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Sodium-dependent proline transporter (SLC6A7) DTT Info
DTP DTT Type Literature-reported
2 Investigative Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
LP-403812 DMIWMZY Discovery agent N.A. Investigative [1]
PMID25037917C58 DMJPR8M Discovery agent N.A. Investigative [2]
------------------------------------------------------------------------------------

References

1 Discovery and characterization of potent small molecule inhibitors of the high affinity proline transporter. Neurosci Lett. 2009 Feb 27;451(3):212-6.
2 Novel inhibitors of the high-affinity L-proline transporter as potential therapeutic agents for the treatment of cognitive disorders. Bioorg Med Chem Lett. 2014 Aug 15;24(16):3886-90.
3 A new association between polymorphisms of the SLC6A7 gene in the chromosome 5q31-32 region and asthma. J Hum Genet. 2010 Jun;55(6):358-65.