Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTHEMTY)

DTP Name Mitochondrial ornithine transporter 1 (SLC25A15)
Gene Name SLC25A15
UniProt ID
Q9Y619 (ORNT1_HUMAN)
VARIDT ID
DTD0173
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms D13S327; HHH; ORC1; ORNT1; SLC25A15; SP1855; Solute carrier family 25 member 15
DTP Family Mitochondrial Carrier (MC) Family ;
Tissue Specificity Highly expressed in liver, pancreas, testis,lung and small intestine. Lower levels are detected in spleen,kidney, brain and heart.
Sequence
MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGF
RGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFA
ALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLRE
VPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVL
SMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEA
Y
Function This transporter is ornithine-citrulline antiporter and it connects the cytosolic and the intramitochondrial reactions of the urea cycle by exchanging cytosolic ornithine with matrix citrulline.
Endogenous Substrate(s) Ornithine; Citrulline
TCDB ID
2.A.29.19.2
Gene ID
10166
Reactome Pathway
Urea cycle (R-HSA-70635 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.01E-03 -1.27E-01 -3.08E-01
Adrenocortical carcinoma 2D11.Z Kidney 2.17E-06 2.87E-01 1.20E+00
Alopecia ED70 Skin from scalp 2.31E-01 3.69E-02 1.40E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.07E-07 -1.64E-01 -7.78E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.62E-01 4.91E-02 2.99E-01
Aortic stenosis BB70 Calcified aortic valve 2.07E-01 9.85E-02 4.78E-01
Apnea 7A40 Hyperplastic tonsil 4.87E-01 5.45E-02 1.33E-01
Arthropathy FA00-FA5Z Peripheral blood 2.02E-02 -2.66E-01 -1.43E+00
Asthma CA23 Nasal and bronchial airway 8.59E-06 2.32E-01 6.65E-01
Atopic dermatitis EA80 Skin 5.79E-02 6.16E-02 4.44E-01
Autism 6A02 Whole blood 1.30E-01 -1.92E-02 -9.65E-02
Autoimmune uveitis 9A96 Peripheral monocyte 6.65E-01 3.50E-02 2.01E-01
Autosomal dominant monocytopenia 4B04 Whole blood 9.91E-01 9.05E-03 9.46E-02
Bacterial infection of gingival 1C1H Gingival tissue 2.09E-02 -8.90E-02 -3.32E-01
Batten disease 5C56.1 Whole blood 9.45E-02 -2.25E-01 -2.85E+00
Behcet's disease 4A62 Peripheral blood 1.94E-01 -1.54E-01 -6.51E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.52E-01 -2.07E-02 -1.50E-01
Bladder cancer 2C94 Bladder tissue 1.63E-04 5.27E-01 2.05E+00
Breast cancer 2C60-2C6Z Breast tissue 9.10E-59 4.25E-01 1.25E+00
Cardioembolic stroke 8B11.20 Whole blood 6.17E-01 7.83E-02 4.35E-01
Cervical cancer 2C77 Cervical tissue 6.83E-01 -3.24E-02 -1.21E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.09E-01 1.66E-01 3.33E-01
Chronic hepatitis C 1E51.1 Whole blood 8.03E-01 -4.19E-02 -1.14E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.94E-01 7.85E-02 3.49E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.09E-04 -1.80E-01 -8.77E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.90E-02 1.30E-01 9.84E-01
Colon cancer 2B90 Colon tissue 1.42E-47 7.23E-01 1.68E+00
Coronary artery disease BA80-BA8Z Peripheral blood 9.78E-01 3.86E-02 8.40E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.65E-01 1.72E-02 5.74E-02
Endometriosis GA10 Endometrium tissue 4.53E-03 -2.65E-01 -4.89E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.60E-02 -1.11E-01 -6.08E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.22E-01 -1.58E-01 -9.76E-01
Gastric cancer 2B72 Gastric tissue 2.33E-01 3.43E-01 4.88E-01
Glioblastopma 2A00.00 Nervous tissue 4.89E-115 5.12E-01 1.78E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.33E-05 7.82E-01 2.30E+00
Head and neck cancer 2D42 Head and neck tissue 2.59E-21 4.22E-01 1.81E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.34E-02 -1.76E-01 -7.68E-01
Huntington's disease 8A01.10 Whole blood 5.69E-01 1.20E-02 6.64E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.30E-01 1.94E-02 1.04E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.48E-01 5.53E-02 6.35E-01
Influenza 1.00E+30 Whole blood 2.52E-02 -3.35E-01 -3.66E+00
Interstitial cystitis GC00.3 Bladder tissue 1.49E-02 2.33E-01 1.35E+00
Intracranial aneurysm 8B01.0 Intracranial artery 8.76E-05 4.34E-01 1.77E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.95E-01 9.01E-02 3.88E-01
Ischemic stroke 8B11 Peripheral blood 4.40E-02 -1.16E-01 -7.03E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.76E-01 -5.15E-02 -1.69E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.79E-01 1.24E-01 6.40E-01
Lateral sclerosis 8B60.4 Skin 1.40E-01 3.46E-01 1.74E+00
Liver cancer 2C12.0 Liver tissue 5.31E-05 -8.16E-01 -8.87E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.56E-02 -1.36E+00 -2.55E+00
Lung cancer 2C25 Lung tissue 3.26E-110 5.94E-01 2.51E+00
Lupus erythematosus 4A40 Whole blood 4.21E-05 -1.44E-01 -5.14E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.98E-01 -2.33E-02 -9.09E-02
Major depressive disorder 6A70-6A7Z Hippocampus 8.07E-01 4.21E-03 3.25E-02
Melanoma 2C30 Skin 1.26E-01 1.25E-01 2.17E-01
Multiple myeloma 2A83.1 Bone marrow 2.00E-02 -3.03E-01 -1.42E+00
Multiple myeloma 2A83.1 Peripheral blood 8.90E-01 -2.87E-02 -1.01E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.46E-01 -1.99E-01 -6.58E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.34E-01 2.64E-01 4.95E-01
Myelofibrosis 2A20.2 Whole blood 1.78E-02 -1.20E-01 -1.20E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.18E-03 -1.68E-01 -3.65E-01
Myopathy 8C70.6 Muscle tissue 6.84E-02 1.83E-01 6.73E-01
Neonatal sepsis KA60 Whole blood 1.04E-19 -3.49E-01 -1.33E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.27E-07 5.81E-01 2.76E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.61E-01 2.25E-01 2.73E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.97E-01 -8.38E-02 -5.12E-01
Olive pollen allergy CA08.00 Peripheral blood 6.81E-01 -6.41E-02 -1.70E-01
Oral cancer 2B6E Oral tissue 5.20E-06 3.01E-01 8.77E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.63E-01 2.80E-01 3.41E-01
Osteoporosis FB83.1 Bone marrow 8.46E-01 4.19E-02 1.07E-01
Ovarian cancer 2C73 Ovarian tissue 6.23E-04 6.60E-01 1.52E+00
Pancreatic cancer 2C10 Pancreas 1.02E-02 -1.23E+00 -9.87E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.48E-02 -2.26E-01 -8.51E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.05E-01 -1.06E-02 -5.20E-02
Pituitary cancer 2D12 Pituitary tissue 9.21E-03 5.17E-01 1.34E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.02E-03 6.28E-01 1.76E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.16E-01 3.73E-02 3.10E-01
Polycythemia vera 2A20.4 Whole blood 3.50E-07 -7.61E-02 -8.57E-01
Pompe disease 5C51.3 Biceps muscle 5.57E-04 4.22E-01 2.50E+00
Preterm birth KA21.4Z Myometrium 4.48E-01 3.95E-02 4.42E-01
Prostate cancer 2C82 Prostate 2.30E-13 6.45E-01 2.73E+00
Psoriasis EA90 Skin 6.05E-12 4.45E-01 1.02E+00
Rectal cancer 2B92 Rectal colon tissue 1.24E-03 4.61E-01 2.01E+00
Renal cancer 2C90-2C91 Kidney 1.91E-01 -2.63E-01 -1.10E+00
Retinoblastoma 2D02.2 Uvea 6.38E-10 1.38E+00 9.95E+00
Rheumatoid arthritis FA20 Synovial tissue 1.79E-03 7.16E-01 2.42E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.91E-01 -3.52E-02 -2.54E-01
Schizophrenia 6A20 Prefrontal cortex 8.04E-02 -5.47E-02 -2.31E-01
Schizophrenia 6A20 Superior temporal cortex 2.53E-01 -6.40E-02 -4.11E-01
Scleroderma 4A42.Z Whole blood 1.76E-01 2.99E-02 1.54E-01
Seizure 8A60-8A6Z Whole blood 8.28E-01 1.61E-01 4.82E-01
Sensitive skin EK0Z Skin 5.76E-01 2.03E-02 2.20E-01
Sepsis with septic shock 1G41 Whole blood 1.33E-32 -3.26E-01 -1.45E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.58E-03 -3.54E-01 -1.60E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.77E-02 3.60E-01 1.38E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 4.96E-01 -4.14E-01 -1.14E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.93E-01 -9.10E-02 -4.11E-01
Skin cancer 2C30-2C3Z Skin 5.56E-63 8.01E-01 1.82E+00
Thrombocythemia 3B63 Whole blood 1.64E-02 -5.89E-02 -5.91E-01
Thrombocytopenia 3B64 Whole blood 3.32E-01 -4.06E-01 -1.01E+00
Thyroid cancer 2D10 Thyroid 9.93E-39 -2.61E+00 -2.10E+00
Tibial muscular dystrophy 8C75 Muscle tissue 4.28E-02 4.09E-01 8.47E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.02E-01 5.87E-02 2.07E-01
Type 2 diabetes 5A11 Liver tissue 6.86E-02 -2.95E-01 -1.39E+00
Ureter cancer 2C92 Urothelium 9.70E-01 3.56E-02 2.30E-01
Uterine cancer 2C78 Endometrium tissue 5.78E-07 -3.44E-01 -6.10E-01
Vitiligo ED63.0 Skin 7.56E-01 1.06E-02 4.73E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases