Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTHKL3Q)

DTP Name Basolateral Na-K-Cl symporter (SLC12A2)
Gene Name SLC12A2
UniProt ID
P55011 (S12A2_HUMAN)
VARIDT ID
DTD0083
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms Basolateral Na-K-Cl symporter; Solute carrier family 12 member 2; SLC12A2; NKCC1
DTP Family Cation-Chloride Cotransporter (CCC) Family ;
Tissue Specificity Expressed in many tissues.
Sequence
MEPRPTAPSSGAPGLAGVGETPSAAALAAARVELPGTAVPSVPEDAAPASRDGGGVRDEG
PAAAGDGLGRPLGPTPSQSRFQVDLVSENAGRAAAAAAAAAAAAAAAGAGAGAKQTPADG
EASGESEPAKGSEEAKGRFRVNFVDPAASSSAEDSLSDAAGVGVDGPNVSFQNGGDTVLS
EGSSLHSGGGGGSGHHQHYYYDTHTNTYYLRTFGHNTMDAVPRIDHYRHTAAQLGEKLLR
PSLAELHDELEKEPFEDGFANGEESTPTRDAVVTYTAESKGVVKFGWIKGVLVRCMLNIW
GVMLFIRLSWIVGQAGIGLSVLVIMMATVVTTITGLSTSAIATNGFVRGGGAYYLISRSL
GPEFGGAIGLIFAFANAVAVAMYVVGFAETVVELLKEHSILMIDEINDIRIIGAITVVIL
LGISVAGMEWEAKAQIVLLVILLLAIGDFVIGTFIPLESKKPKGFFGYKSEIFNENFGPD
FREEETFFSVFAIFFPAATGILAGANISGDLADPQSAIPKGTLLAILITTLVYVGIAVSV
GSCVVRDATGNVNDTIVTELTNCTSAACKLNFDFSSCESSPCSYGLMNNFQVMSMVSGFT
PLISAGIFSATLSSALASLVSAPKIFQALCKDNIYPAFQMFAKGYGKNNEPLRGYILTFL
IALGFILIAELNVIAPIISNFFLASYALINFSVFHASLAKSPGWRPAFKYYNMWISLLGA
ILCCIVMFVINWWAALLTYVIVLGLYIYVTYKKPDVNWGSSTQALTYLNALQHSIRLSGV
EDHVKNFRPQCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQA
KYQRWLIKNKMKAFYAPVHADDLREGAQYLMQAAGLGRMKPNTLVLGFKKDWLQADMRDV
DMYINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKS
DLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLEASTQFQKKQG
KNTIDVWWLFDDGGLTLLIPYLLTTKKKWKDCKIRVFIGGKINRIDHDRRAMATLLSKFR
IDFSDIMVLGDINTKPKKENIIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELE
LYKTKTYRQIRLNELLKEHSSTANIIVMSLPVARKGAVSSALYMAWLEALSKDLPPILLV
RGNHQSVLTFYS
Function This transporter mediates sodium and chloride reabsorption, and plays a vital role in the regulation of ionic balance and cell volume.
Endogenous Substrate(s) Sodium; Chloride
TCDB ID
2.A.30.1.4
Gene ID
6558
KEGG Pathway
Salivary secretion (hsa04970 )
Pancreatic secretion (hsa04972 )
Vibrio cholerae infection (hsa05110 )
Reactome Pathway
Cation-coupled Chloride cotransporters (R-HSA-426117 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
2 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Potassium Chloride DMMTAJC Hypokalemia 5C77 Approved [1]
Sodium chloride DMM3950 Skin burns ME65.0 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 8.05E-15 4.35E-01 1.18E+00
Adrenocortical carcinoma 2D11.Z Kidney 1.57E-01 -5.43E-01 -7.01E-01
Alopecia ED70 Skin from scalp 2.77E-01 5.04E-02 1.07E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.72E-01 4.29E-04 7.46E-04
Ankylosing spondylitis FA92.0 Pheripheral blood 7.44E-01 -7.64E-02 -5.69E-01
Aortic stenosis BB70 Calcified aortic valve 7.17E-01 -2.91E-02 -4.36E-02
Apnea 7A40 Hyperplastic tonsil 9.43E-01 1.41E-01 4.28E-01
Arthropathy FA00-FA5Z Peripheral blood 1.07E-01 -1.02E-01 -4.29E-01
Asthma CA23 Nasal and bronchial airway 2.63E-03 1.93E-01 3.57E-01
Atopic dermatitis EA80 Skin 5.78E-02 6.08E-02 1.29E-01
Autism 6A02 Whole blood 3.17E-01 6.55E-02 2.58E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.92E-01 6.19E-02 2.78E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.22E-01 2.70E-01 8.15E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.81E-04 -1.17E-01 -3.60E-01
Batten disease 5C56.1 Whole blood 9.20E-01 -1.17E-01 -4.63E-01
Behcet's disease 4A62 Peripheral blood 7.35E-01 5.30E-02 2.12E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.56E-01 -4.29E-02 -1.47E-01
Bladder cancer 2C94 Bladder tissue 9.76E-01 6.84E-02 2.95E-01
Breast cancer 2C60-2C6Z Breast tissue 3.66E-01 -2.27E-01 -2.51E-01
Cardioembolic stroke 8B11.20 Whole blood 7.73E-01 1.77E-01 4.30E-01
Cervical cancer 2C77 Cervical tissue 6.04E-01 -1.50E-01 -3.51E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.11E-01 -1.43E-01 -2.08E-01
Chronic hepatitis C 1E51.1 Whole blood 5.77E-01 -1.23E-02 -2.53E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 3.69E-02 -2.60E-01 -7.18E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.28E-03 -1.22E-01 -2.75E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.88E-02 5.21E-01 6.35E-01
Colon cancer 2B90 Colon tissue 8.16E-84 1.21E+00 2.84E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.13E-01 1.59E-01 7.32E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.34E-01 2.26E-01 2.57E-01
Endometriosis GA10 Endometrium tissue 3.76E-02 -4.12E-01 -9.67E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.25E-01 4.38E-02 1.60E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.36E-01 8.71E-02 4.41E-01
Gastric cancer 2B72 Gastric tissue 5.73E-01 3.50E-01 2.78E-01
Glioblastopma 2A00.00 Nervous tissue 2.73E-12 -2.38E-01 -3.54E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.50E-04 -7.67E-01 -2.61E+00
Head and neck cancer 2D42 Head and neck tissue 1.26E-05 -9.40E-01 -7.65E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.94E-01 2.50E-01 3.01E-01
Huntington's disease 8A01.10 Whole blood 7.20E-02 -1.45E-01 -8.83E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.67E-01 1.20E-01 3.43E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.56E-01 8.05E-04 5.99E-03
Influenza 1.00E+30 Whole blood 3.70E-01 -1.74E-01 -1.73E+00
Interstitial cystitis GC00.3 Bladder tissue 7.85E-01 -5.66E-03 -2.54E-02
Intracranial aneurysm 8B01.0 Intracranial artery 2.81E-01 3.57E-01 5.22E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.07E-01 5.65E-02 2.60E-01
Ischemic stroke 8B11 Peripheral blood 5.02E-01 2.67E-02 9.54E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.17E-01 -1.25E-01 -2.46E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.71E-01 -2.50E-01 -6.66E-01
Lateral sclerosis 8B60.4 Skin 4.15E-01 7.71E-02 1.81E-01
Liver cancer 2C12.0 Liver tissue 6.49E-09 3.17E-01 6.81E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.11E-05 1.88E+00 3.36E+00
Lung cancer 2C25 Lung tissue 5.51E-04 8.84E-02 2.21E-01
Lupus erythematosus 4A40 Whole blood 1.01E-01 -4.51E-02 -8.88E-02
Major depressive disorder 6A70-6A7Z Whole blood 6.45E-01 -1.88E-02 -5.18E-02
Major depressive disorder 6A70-6A7Z Hippocampus 9.70E-01 -6.56E-02 -2.18E-01
Melanoma 2C30 Skin 1.02E-03 -1.63E+00 -1.27E+00
Multiple myeloma 2A83.1 Bone marrow 2.54E-07 9.85E-01 4.83E+00
Multiple myeloma 2A83.1 Peripheral blood 2.67E-01 -1.41E-01 -4.44E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.16E-01 1.13E-01 5.31E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.19E-09 -4.06E-01 -1.49E+00
Myelofibrosis 2A20.2 Whole blood 3.26E-01 1.16E-01 4.77E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.92E-01 -2.01E-01 -2.84E-01
Myopathy 8C70.6 Muscle tissue 8.20E-01 1.67E-02 1.18E-01
Neonatal sepsis KA60 Whole blood 3.32E-08 -5.21E-01 -1.13E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.70E-04 -1.13E+00 -2.27E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.63E-01 8.98E-02 2.27E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.09E-01 -2.57E-01 -6.74E-01
Olive pollen allergy CA08.00 Peripheral blood 9.14E-01 1.56E-01 6.36E-01
Oral cancer 2B6E Oral tissue 4.44E-01 6.68E-01 4.05E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.88E-01 9.26E-02 1.65E-01
Osteoporosis FB83.1 Bone marrow 5.13E-02 -3.04E-01 -8.12E-01
Ovarian cancer 2C73 Ovarian tissue 7.24E-04 7.45E-01 1.60E+00
Pancreatic cancer 2C10 Pancreas 6.30E-04 1.64E+00 1.51E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 9.87E-01 -3.01E-02 -7.47E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.84E-02 -1.98E-01 -1.03E+00
Pituitary cancer 2D12 Pituitary tissue 7.95E-02 -4.04E-01 -8.82E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.35E-03 -5.57E-01 -1.29E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.94E-01 -7.12E-02 -1.87E-01
Polycythemia vera 2A20.4 Whole blood 4.46E-02 -1.27E-01 -4.66E-01
Pompe disease 5C51.3 Biceps muscle 6.84E-02 -5.34E-01 -1.63E+00
Preterm birth KA21.4Z Myometrium 3.18E-01 1.04E-01 8.96E-01
Prostate cancer 2C82 Prostate 1.04E-01 3.16E-01 3.82E-01
Psoriasis EA90 Skin 1.22E-20 -9.65E-01 -1.50E+00
Rectal cancer 2B92 Rectal colon tissue 7.70E-05 1.15E+00 3.69E+00
Renal cancer 2C90-2C91 Kidney 1.55E-02 6.64E-01 9.76E-01
Retinoblastoma 2D02.2 Uvea 2.23E-06 -1.05E+00 -4.82E+00
Rheumatoid arthritis FA20 Synovial tissue 1.97E-01 -2.06E-01 -3.06E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.58E-01 1.09E-01 3.42E-01
Schizophrenia 6A20 Prefrontal cortex 2.18E-02 -1.75E-01 -2.45E-01
Schizophrenia 6A20 Superior temporal cortex 4.55E-03 -2.63E-01 -8.25E-01
Scleroderma 4A42.Z Whole blood 6.57E-06 -2.99E-01 -2.74E+00
Seizure 8A60-8A6Z Whole blood 6.22E-01 1.70E-02 3.35E-02
Sensitive skin EK0Z Skin 1.65E-02 -6.29E-01 -1.12E+00
Sepsis with septic shock 1G41 Whole blood 1.95E-25 -5.31E-01 -1.46E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.79E-01 -3.38E-01 -1.16E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.91E-03 -2.59E-01 -1.03E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.90E-01 -1.07E-01 -2.28E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.51E-01 1.20E-01 2.63E-01
Skin cancer 2C30-2C3Z Skin 6.27E-79 -1.92E+00 -2.12E+00
Thrombocythemia 3B63 Whole blood 7.96E-01 7.56E-02 2.94E-01
Thrombocytopenia 3B64 Whole blood 2.95E-01 -1.36E-01 -1.59E-01
Thyroid cancer 2D10 Thyroid 1.64E-42 7.03E-01 2.39E+00
Tibial muscular dystrophy 8C75 Muscle tissue 5.19E-05 5.71E-01 1.51E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.23E-01 -6.29E-02 -2.09E-01
Type 2 diabetes 5A11 Liver tissue 7.54E-02 1.68E-01 9.71E-01
Ureter cancer 2C92 Urothelium 2.50E-01 -2.16E-02 -1.85E-01
Uterine cancer 2C78 Endometrium tissue 1.05E-03 9.95E-02 1.42E-01
Vitiligo ED63.0 Skin 9.32E-01 2.97E-01 2.93E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Expression of the sodium potassium chloride cotransporter (NKCC1) and sodium chloride cotransporter (NCC) and their effects on rat lens transparency. Mol Vis. 2010 May 4;16:800-12.