Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTHSNUW)

DTP Name Brain mitochondrial carrier protein 1 (SLC25A14)
Gene Name SLC25A14
UniProt ID
O95258 (UCP5_HUMAN)
VARIDT ID
DTD0172
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms BMCP-1; BMCP1; Mitochondrial uncoupling protein 5; SLC25A14; Solute carrier family 25 member 14; UCP 5; UCP5; UNQ791/PRO1682
DTP Family Mitochondrial Carrier (MC) Family ;
Tissue Specificity Mainly expressed in brain. Some expression intestis and pituitary.
Sequence
MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFP
VDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTI
KIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSM
IGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFV
SSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFW
PNWLRLGPWNIIFFITYEQLKRLQI
Function This transporter participates in the mitochondrial proton leak measured in brain mitochondria.
Endogenous Substrate(s) H+; Cl-
TCDB ID
2.A.29.24.1
Gene ID
9016
Reactome Pathway
The proton buffering model (R-HSA-167827 )
The fatty acid cycling model (R-HSA-167826 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.97E-10 1.56E-01 7.90E-01
Adrenocortical carcinoma 2D11.Z Kidney 2.47E-03 2.21E-01 7.37E-01
Alopecia ED70 Skin from scalp 1.05E-01 -4.84E-02 -3.31E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.85E-09 -3.99E-01 -1.04E+00
Ankylosing spondylitis FA92.0 Pheripheral blood 6.69E-02 2.55E-01 1.29E+00
Aortic stenosis BB70 Calcified aortic valve 6.16E-01 -2.39E-01 -3.42E-01
Apnea 7A40 Hyperplastic tonsil 1.76E-01 1.96E-01 1.03E+00
Arthropathy FA00-FA5Z Peripheral blood 4.66E-01 1.14E-01 8.50E-01
Asthma CA23 Nasal and bronchial airway 4.82E-03 -1.59E-01 -3.31E-01
Atopic dermatitis EA80 Skin 1.36E-04 1.35E-01 7.91E-01
Autism 6A02 Whole blood 4.08E-01 3.99E-02 2.21E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.68E-02 1.29E-01 8.71E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.56E-01 -2.02E-01 -7.95E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.63E-01 -2.33E-02 -1.03E-01
Batten disease 5C56.1 Whole blood 7.58E-01 -3.55E-02 -1.24E-01
Behcet's disease 4A62 Peripheral blood 7.86E-01 5.90E-02 3.44E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.63E-01 -6.72E-02 -2.55E-01
Bladder cancer 2C94 Bladder tissue 6.31E-01 -3.86E-02 -2.38E-01
Breast cancer 2C60-2C6Z Breast tissue 1.96E-46 5.27E-01 1.20E+00
Cardioembolic stroke 8B11.20 Whole blood 4.56E-01 -3.61E-02 -1.68E-01
Cervical cancer 2C77 Cervical tissue 5.90E-02 1.45E-01 4.44E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.27E-01 -1.34E-01 -5.17E-01
Chronic hepatitis C 1E51.1 Whole blood 8.69E-01 -3.70E-02 -1.72E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.60E-01 3.29E-02 2.13E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.58E-01 4.62E-03 1.47E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.01E-02 -7.72E-01 -2.46E+00
Colon cancer 2B90 Colon tissue 3.97E-102 5.57E-01 2.85E+00
Coronary artery disease BA80-BA8Z Peripheral blood 4.90E-01 1.82E-01 2.42E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.52E-01 9.16E-02 2.01E-01
Endometriosis GA10 Endometrium tissue 4.84E-01 -2.36E-02 -5.90E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.84E-01 1.21E-02 7.12E-02
Familial hypercholesterolemia 5C80.00 Whole blood 8.01E-01 -8.42E-03 -5.34E-02
Gastric cancer 2B72 Gastric tissue 1.83E-01 2.84E-01 5.71E-01
Glioblastopma 2A00.00 Nervous tissue 1.07E-23 -5.01E-01 -8.73E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.54E-03 4.03E-01 1.29E+00
Head and neck cancer 2D42 Head and neck tissue 2.59E-08 -1.78E-01 -2.16E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.04E-01 -4.82E-01 -1.15E+00
Huntington's disease 8A01.10 Whole blood 7.49E-01 -7.01E-02 -8.41E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.97E-01 -2.78E-02 -1.10E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.19E-02 -2.06E-01 -1.06E+00
Influenza 1.00E+30 Whole blood 4.55E-01 2.13E-01 1.10E+00
Interstitial cystitis GC00.3 Bladder tissue 5.49E-01 -1.03E-01 -5.56E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.19E-02 1.16E-01 7.37E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.81E-01 2.99E-02 1.32E-01
Ischemic stroke 8B11 Peripheral blood 4.38E-01 -6.77E-02 -5.59E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.38E-01 7.80E-02 1.74E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.92E-01 1.58E-01 1.68E-01
Lateral sclerosis 8B60.4 Skin 2.01E-01 1.25E-01 6.90E-01
Liver cancer 2C12.0 Liver tissue 2.18E-05 2.47E-01 7.68E-01
Liver failure DB99.7-DB99.8 Liver tissue 5.73E-03 -3.23E-01 -1.54E+00
Lung cancer 2C25 Lung tissue 1.25E-38 2.93E-01 1.26E+00
Lupus erythematosus 4A40 Whole blood 5.10E-05 4.12E-01 5.19E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.28E-02 6.34E-02 3.54E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.86E-01 3.83E-03 1.64E-02
Melanoma 2C30 Skin 3.01E-01 -2.58E-01 -4.96E-01
Multiple myeloma 2A83.1 Bone marrow 3.32E-05 4.94E-01 2.59E+00
Multiple myeloma 2A83.1 Peripheral blood 8.34E-01 -8.72E-02 -1.87E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.47E-01 -1.57E-01 -8.32E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.60E-03 -2.45E-01 -6.98E-01
Myelofibrosis 2A20.2 Whole blood 3.80E-03 -8.21E-02 -7.75E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.40E-02 -2.28E-01 -2.73E-01
Myopathy 8C70.6 Muscle tissue 4.94E-03 2.62E-01 1.06E+00
Neonatal sepsis KA60 Whole blood 1.02E-03 1.01E-01 4.02E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.82E-05 1.08E+00 2.71E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.20E-01 6.47E-02 3.08E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.94E-03 -2.85E-01 -1.74E+00
Olive pollen allergy CA08.00 Peripheral blood 5.96E-01 -1.82E-01 -8.15E-01
Oral cancer 2B6E Oral tissue 3.59E-06 4.25E-01 1.04E+00
Osteoarthritis FA00-FA0Z Synovial tissue 6.65E-01 4.76E-02 2.25E-01
Osteoporosis FB83.1 Bone marrow 4.92E-03 -4.77E-01 -1.84E+00
Ovarian cancer 2C73 Ovarian tissue 2.44E-02 2.36E-01 6.36E-01
Pancreatic cancer 2C10 Pancreas 1.15E-01 2.08E-01 6.53E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.64E-01 -4.34E-01 -8.87E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.27E-01 -1.87E-02 -1.16E-01
Pituitary cancer 2D12 Pituitary tissue 2.71E-01 -1.13E-01 -2.99E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.07E-01 8.88E-04 2.89E-03
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.41E-01 -3.18E-02 -4.51E-01
Polycythemia vera 2A20.4 Whole blood 2.01E-02 -8.72E-02 -7.61E-01
Pompe disease 5C51.3 Biceps muscle 1.91E-03 3.85E-01 2.91E+00
Preterm birth KA21.4Z Myometrium 3.58E-01 1.76E-02 1.55E-01
Prostate cancer 2C82 Prostate 8.34E-08 9.17E-01 2.10E+00
Psoriasis EA90 Skin 2.16E-23 3.64E-01 1.15E+00
Rectal cancer 2B92 Rectal colon tissue 7.10E-03 2.80E-01 1.63E+00
Renal cancer 2C90-2C91 Kidney 1.01E-03 3.92E-01 1.46E+00
Retinoblastoma 2D02.2 Uvea 2.17E-04 -8.73E-01 -4.37E+00
Rheumatoid arthritis FA20 Synovial tissue 2.68E-02 -2.87E-01 -1.79E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.54E-01 -4.60E-02 -1.66E-01
Schizophrenia 6A20 Prefrontal cortex 9.42E-03 -5.40E-01 -7.01E-01
Schizophrenia 6A20 Superior temporal cortex 4.91E-01 -6.92E-02 -2.09E-01
Scleroderma 4A42.Z Whole blood 5.39E-04 1.10E-01 1.89E+00
Seizure 8A60-8A6Z Whole blood 7.02E-01 3.26E-02 1.94E-01
Sensitive skin EK0Z Skin 1.53E-01 4.16E-02 6.98E-01
Sepsis with septic shock 1G41 Whole blood 5.61E-03 -7.79E-02 -3.14E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.01E-02 -3.23E-01 -1.44E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.43E-02 -1.96E-01 -7.22E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.80E-01 -1.40E-01 -5.58E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.57E-01 1.47E-01 1.23E+00
Skin cancer 2C30-2C3Z Skin 3.78E-22 4.55E-01 1.07E+00
Thrombocythemia 3B63 Whole blood 4.60E-01 3.82E-02 3.56E-01
Thrombocytopenia 3B64 Whole blood 7.51E-01 4.92E-02 1.74E-01
Thyroid cancer 2D10 Thyroid 8.05E-04 -1.89E-01 -7.67E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.45E-02 1.96E-01 6.67E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.32E-03 -8.83E-01 -7.30E+00
Type 2 diabetes 5A11 Liver tissue 8.70E-01 -2.98E-02 -1.02E-01
Ureter cancer 2C92 Urothelium 6.59E-01 3.15E-03 1.40E-02
Uterine cancer 2C78 Endometrium tissue 1.13E-16 3.82E-01 8.81E-01
Vitiligo ED63.0 Skin 1.87E-03 1.84E-01 2.29E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases