Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTHWCVA)

DTP Name Sodium- and chloride-dependent taurine transporter (SLC6A6)
Gene Name SLC6A6
UniProt ID
P31641 (SC6A6_HUMAN)
VARIDT ID
DTD0458
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC6A6; Solute carrier family 6 member 6; TAUT
DTP Family Neurotransmitter:Sodium Symporter (NSS) Family ;
Tissue Specificity Expressed abundantly in placenta and skeletalmuscle, at intermediate levels in heart, brain, lung, kidney andpancreas and at low levels in liver.
Sequence
MATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVG
LGNVWRFPYLCYKNGGGAFLIPYFIFLFGSGLPVFFLEIIIGQYTSEGGITCWEKICPLF
SGIGYASVVIVSLLNVYYIVILAWATYYLFQSFQKELPWAHCNHSWNTPHCMEDTMRKNK
SVWITISSTNFTSPVIEFWERNVLSLSPGIDHPGSLKWDLALCLLLVWLVCFFCIWKGVR
STGKVVYFTATFPFAMLLVLLVRGLTLPGAGAGIKFYLYPDITRLEDPQVWIDAGTQIFF
SYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGFMAQEQGVDIA
DVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLYPS
FLRKGYRREIFIAFVCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFVIA
WIYGGDNLYDGIEDMIGYRPGPWMKYSWAVITPVLCVGCFIFSLVKYVPLTYNKTYVYPN
WAIGLGWSLALSSMLCVPLVIVIRLCQTEGPFLVRVKYLLTPREPNRWAVEREGATPYNS
RTVMNGALVKPTHIIVETMM
Function This sodium-dependent transporter mediates the transport of taurine and beta-alanine.
Endogenous Substrate(s) Na+
TCDB ID
2.A.22.3.3
Gene ID
6533
Reactome Pathway
Na+/Cl- dependent neurotransmitter transporters (R-HSA-442660 )
Amino acid transport across the plasma membrane (R-HSA-352230 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
2 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Beta-Alanine DMC64EI Discovery agent N.A. Investigative [1]
taurine DMVW7N3 Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.23E-01 2.39E-02 2.35E-02
Adrenocortical carcinoma 2D11.Z Kidney 9.42E-01 -2.48E-01 -4.28E-01
Alopecia ED70 Skin from scalp 9.17E-01 1.66E-02 4.18E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.95E-01 -1.00E-01 -3.83E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 3.85E-01 6.81E-01 9.00E-01
Aortic stenosis BB70 Calcified aortic valve 6.76E-01 3.22E-02 6.51E-02
Apnea 7A40 Hyperplastic tonsil 6.05E-02 -2.44E-01 -1.67E+00
Arthropathy FA00-FA5Z Peripheral blood 1.97E-01 7.05E-01 1.15E+00
Asthma CA23 Nasal and bronchial airway 2.42E-01 -6.24E-02 -3.05E-02
Atopic dermatitis EA80 Skin 2.14E-01 1.24E-02 4.37E-02
Autism 6A02 Whole blood 4.69E-02 -3.07E-01 -4.88E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.94E-01 -3.25E-01 -9.75E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.46E-01 -3.83E-01 -9.24E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.67E-09 2.94E-01 8.36E-01
Batten disease 5C56.1 Whole blood 8.31E-01 -1.57E-02 -8.93E-02
Behcet's disease 4A62 Peripheral blood 5.80E-01 8.20E-02 2.66E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.55E-01 -3.92E-02 -4.14E-01
Bladder cancer 2C94 Bladder tissue 2.16E-04 5.42E-01 2.48E+00
Breast cancer 2C60-2C6Z Breast tissue 3.12E-02 5.55E-02 1.63E-01
Cardioembolic stroke 8B11.20 Whole blood 7.53E-03 3.26E-01 5.89E-01
Cervical cancer 2C77 Cervical tissue 5.17E-01 2.84E-02 1.00E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.53E-01 7.49E-01 4.47E-01
Chronic hepatitis C 1E51.1 Whole blood 2.77E-01 1.44E-01 4.32E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.49E-02 1.70E-01 5.51E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.62E-02 -4.20E-01 -5.41E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.01E-01 3.50E-01 1.01E+00
Colon cancer 2B90 Colon tissue 8.08E-86 6.38E-01 2.45E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.60E-02 1.00E-01 9.01E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.71E-01 -1.74E-01 -9.00E-01
Endometriosis GA10 Endometrium tissue 5.06E-01 1.23E-01 2.14E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.45E-02 -5.48E-02 -5.99E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.43E-04 -3.37E-01 -9.14E-01
Gastric cancer 2B72 Gastric tissue 3.97E-01 4.50E-02 1.52E-01
Glioblastopma 2A00.00 Nervous tissue 4.96E-25 -3.28E-01 -8.81E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.80E-01 -1.73E-01 -2.22E-01
Head and neck cancer 2D42 Head and neck tissue 2.10E-08 -1.34E-01 -1.36E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.60E-01 -6.69E-02 -2.11E-01
Huntington's disease 8A01.10 Whole blood 6.37E-02 1.57E-01 1.34E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.90E-02 -4.65E-01 -1.34E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.03E-06 2.29E-01 4.05E+00
Influenza 1.00E+30 Whole blood 1.43E-01 -1.17E+00 -1.21E+00
Interstitial cystitis GC00.3 Bladder tissue 2.95E-03 4.58E-01 3.04E+00
Intracranial aneurysm 8B01.0 Intracranial artery 5.33E-03 3.84E-01 1.80E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.15E-02 9.27E-02 3.30E-01
Ischemic stroke 8B11 Peripheral blood 9.33E-02 1.94E-01 6.02E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.71E-05 4.67E-01 6.86E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.22E-01 9.61E-02 5.62E-01
Lateral sclerosis 8B60.4 Skin 3.71E-02 1.26E-01 9.02E-01
Liver cancer 2C12.0 Liver tissue 8.59E-01 -8.40E-02 -4.98E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.53E-01 2.36E-03 1.42E-02
Lung cancer 2C25 Lung tissue 1.55E-02 1.12E-01 2.89E-01
Lupus erythematosus 4A40 Whole blood 4.27E-05 6.26E-01 5.38E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.51E-01 7.78E-02 2.11E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.56E-01 -2.16E-02 -2.15E-01
Melanoma 2C30 Skin 9.81E-02 1.46E-01 2.64E-01
Multiple myeloma 2A83.1 Bone marrow 4.76E-01 -1.26E-02 -6.80E-02
Multiple myeloma 2A83.1 Peripheral blood 8.02E-01 -5.59E-02 -1.98E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.42E-01 2.24E-01 6.58E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.76E-01 4.77E-03 1.14E-02
Myelofibrosis 2A20.2 Whole blood 1.32E-02 -2.25E-01 -1.05E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.01E-02 4.48E-01 4.75E-01
Myopathy 8C70.6 Muscle tissue 3.37E-01 -5.98E-02 -2.34E-01
Neonatal sepsis KA60 Whole blood 6.89E-26 9.47E-01 2.45E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 9.46E-06 -6.51E-01 -3.17E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.76E-01 -1.67E-02 -1.20E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.92E-01 4.49E-02 1.68E-01
Olive pollen allergy CA08.00 Peripheral blood 1.71E-01 3.11E-01 1.04E+00
Oral cancer 2B6E Oral tissue 6.55E-03 -1.12E-01 -7.21E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.61E-01 7.29E-03 3.83E-02
Osteoporosis FB83.1 Bone marrow 1.36E-01 4.49E-01 9.22E-01
Ovarian cancer 2C73 Ovarian tissue 2.19E-01 -2.69E-01 -4.90E-01
Pancreatic cancer 2C10 Pancreas 9.59E-04 3.52E-01 1.10E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 8.76E-01 5.05E-02 1.75E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.15E-04 5.21E-01 1.84E+00
Pituitary cancer 2D12 Pituitary tissue 1.32E-01 1.26E-01 4.10E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.90E-01 3.01E-01 1.08E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.02E-02 -6.13E-02 -4.46E-01
Polycythemia vera 2A20.4 Whole blood 1.93E-02 1.04E-02 5.29E-02
Pompe disease 5C51.3 Biceps muscle 2.32E-02 -5.12E-01 -1.02E+00
Preterm birth KA21.4Z Myometrium 1.41E-01 -9.23E-02 -6.89E-01
Prostate cancer 2C82 Prostate 6.87E-01 1.20E-01 1.75E-01
Psoriasis EA90 Skin 4.54E-06 1.29E-01 3.11E-01
Rectal cancer 2B92 Rectal colon tissue 9.23E-04 7.88E-01 2.49E+00
Renal cancer 2C90-2C91 Kidney 5.10E-02 -3.51E-01 -9.05E-01
Retinoblastoma 2D02.2 Uvea 7.58E-07 -2.94E+00 -2.94E+00
Rheumatoid arthritis FA20 Synovial tissue 4.01E-04 5.39E-01 2.18E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.97E-01 6.31E-03 1.54E-02
Schizophrenia 6A20 Prefrontal cortex 9.53E-02 1.17E-01 3.40E-01
Schizophrenia 6A20 Superior temporal cortex 5.13E-01 -2.80E-05 -2.36E-04
Scleroderma 4A42.Z Whole blood 3.57E-02 2.06E-01 4.12E-01
Seizure 8A60-8A6Z Whole blood 4.31E-01 -4.57E-01 -6.22E-01
Sensitive skin EK0Z Skin 5.71E-02 3.06E-01 1.14E+00
Sepsis with septic shock 1G41 Whole blood 5.72E-30 1.03E+00 1.49E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.17E-01 -1.59E-01 -4.38E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.78E-03 2.79E-01 1.12E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 1.38E-01 1.53E-01 9.28E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.62E-01 4.48E-02 2.68E-01
Skin cancer 2C30-2C3Z Skin 2.81E-07 9.90E-02 2.49E-01
Thrombocythemia 3B63 Whole blood 9.01E-01 -1.57E-01 -7.76E-01
Thrombocytopenia 3B64 Whole blood 9.28E-01 -8.01E-02 -1.37E-01
Thyroid cancer 2D10 Thyroid 5.55E-12 2.46E-01 9.16E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.56E-01 2.48E-01 5.83E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.35E-01 1.03E-01 1.66E+00
Type 2 diabetes 5A11 Liver tissue 7.48E-01 4.33E-02 2.30E-01
Ureter cancer 2C92 Urothelium 1.22E-01 -1.40E-01 -9.50E-01
Uterine cancer 2C78 Endometrium tissue 1.92E-03 -5.73E-02 -9.12E-02
Vitiligo ED63.0 Skin 4.73E-01 -2.03E-02 -3.54E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Astrocytic -aminobutyric acid (GABA) transporters mediate guanidinoacetate transport in rat brain. 2018 Feb;113:1-7.