Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTIVJE4)

DTP Name Magnesium transporter protein solute carrier family 41 member 2 (SLC41A2)
Gene Name SLC41A2
UniProt ID
Q96JW4 (S41A2_HUMAN)
VARIDT ID
DTD0355
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC41A1-L1; SLC41A2; Solute carrier family 41 member 2
DTP Family Mg(2+) Transporter-E (MGTE) Family ;
Sequence
MTNSKGRSITDKTSGGPSSGGGFVDWTLRLNTIQSDKFLNLLLSMVPVIYQKNQEDRHKK
ANGIWQDGLSTAVQTFSNRSEQHMEYHSFSEQSFHANNGHASSSCSQKYDDYANYNYCDG
RETSETTAMLQDEDISSDGDEDAIVEVTPKLPKESSGIMALQILVPFLLAGFGTVSAGMV
LDIVQHWEVFRKVTEVFILVPALLGLKGNLEMTLASRLSTAVNIGKMDSPIEKWNLIIGN
LALKQVQATVVGFLAAVAAIILGWIPEGKYYLDHSILLCSSSVATAFIASLLQGIIMVGV
IVGSKKTGINPDNVATPIAASFGDLITLAILAWISQGLYSCLETYYYISPLVGVFFLALT
PIWIIIAAKHPATRTVLHSGWEPVITAMVISSIGGLILDTTVSDPNLVGIVVYTPVINGI
GGNLVAIQASRISTYLHLHSIPGELPDEPKGCYYPFRTFFGPGVNNKSAQVLLLLVIPGH
LIFLYTIHLMKSGHTSLTIIFIVVYLFGAVLQVFTLLWIADWMVHHFWRKGKDPDSFSIP
YLTALGDLLGTALLALSFHFLWLIGDRDGDVGD
Function This tranaporter mediates the transport of magnesium in plasma-membrane.
Endogenous Substrate(s) Mg2+
TCDB ID
1.A.26.2.2
Gene ID
84102
Reactome Pathway
Metal ion SLC transporters (R-HSA-425410 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.39E-01 -4.28E-02 -2.43E-01
Adrenocortical carcinoma 2D11.Z Kidney 6.37E-04 3.77E-01 7.90E-01
Alopecia ED70 Skin from scalp 2.86E-01 -5.33E-02 -1.17E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.07E-01 5.08E-03 2.28E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 3.50E-01 -1.65E-01 -5.15E-01
Aortic stenosis BB70 Calcified aortic valve 9.86E-01 1.79E-01 5.28E-01
Apnea 7A40 Hyperplastic tonsil 4.81E-01 -5.93E-02 -5.11E-01
Arthropathy FA00-FA5Z Peripheral blood 6.61E-01 -4.11E-02 -2.54E-01
Asthma CA23 Nasal and bronchial airway 5.19E-01 -5.98E-02 -9.41E-02
Atopic dermatitis EA80 Skin 1.83E-01 -9.96E-02 -5.76E-01
Autism 6A02 Whole blood 9.22E-01 -1.83E-02 -1.24E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.99E-01 -3.37E-02 -8.53E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.76E-01 6.61E-02 3.28E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.17E-16 4.43E-01 1.40E+00
Batten disease 5C56.1 Whole blood 9.10E-01 1.26E-02 8.71E-02
Behcet's disease 4A62 Peripheral blood 4.97E-01 -7.34E-02 -6.17E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.21E-01 -3.94E-02 -2.03E-01
Bladder cancer 2C94 Bladder tissue 5.18E-05 6.72E-01 2.25E+00
Breast cancer 2C60-2C6Z Breast tissue 4.01E-01 2.86E-02 3.67E-02
Cardioembolic stroke 8B11.20 Whole blood 8.45E-03 2.52E-01 7.00E-01
Cervical cancer 2C77 Cervical tissue 1.91E-01 2.72E-01 5.86E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.33E-02 -9.41E-02 -6.16E-01
Chronic hepatitis C 1E51.1 Whole blood 7.96E-01 -2.74E-02 -1.48E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.27E-02 1.67E-01 5.39E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.13E-02 -2.01E-01 -6.71E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.04E-02 3.75E-01 2.31E+00
Colon cancer 2B90 Colon tissue 5.27E-73 -1.28E+00 -2.44E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.31E-01 -2.68E-02 -2.92E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.47E-01 -2.17E-01 -2.94E-01
Endometriosis GA10 Endometrium tissue 1.30E-02 1.64E-01 4.29E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.85E-01 -3.84E-02 -4.12E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.90E-02 -1.70E-01 -7.99E-01
Gastric cancer 2B72 Gastric tissue 7.17E-01 -3.89E-01 -2.50E-01
Glioblastopma 2A00.00 Nervous tissue 1.08E-48 3.81E-01 1.21E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.63E-02 6.26E-01 5.42E-01
Head and neck cancer 2D42 Head and neck tissue 5.74E-06 2.30E-01 5.14E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.21E-01 -1.08E-01 -3.33E-01
Huntington's disease 8A01.10 Whole blood 9.42E-02 -6.62E-02 -6.84E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.92E-01 -1.60E-02 -2.44E-02
Immunodeficiency 4A00-4A20 Peripheral blood 4.31E-01 -3.16E-02 -4.02E-01
Influenza 1.00E+30 Whole blood 7.28E-03 -1.75E+00 -5.62E+00
Interstitial cystitis GC00.3 Bladder tissue 2.42E-04 9.39E-01 8.72E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.61E-03 7.45E-01 1.42E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.46E-01 1.39E-01 3.35E-01
Ischemic stroke 8B11 Peripheral blood 5.01E-01 -4.99E-03 -2.31E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 9.45E-04 -1.89E-01 -4.65E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.57E-01 -1.52E-01 -2.13E-01
Lateral sclerosis 8B60.4 Skin 7.14E-01 -5.66E-02 -3.23E-01
Liver cancer 2C12.0 Liver tissue 3.71E-31 -1.53E+00 -2.63E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.37E-06 -2.94E+00 -5.65E+00
Lung cancer 2C25 Lung tissue 4.40E-77 1.11E+00 2.32E+00
Lupus erythematosus 4A40 Whole blood 8.16E-02 -1.02E-02 -1.74E-02
Major depressive disorder 6A70-6A7Z Whole blood 5.59E-03 -1.16E-01 -2.85E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.73E-01 -5.56E-02 -3.20E-01
Melanoma 2C30 Skin 6.36E-02 -5.29E-01 -6.75E-01
Multiple myeloma 2A83.1 Bone marrow 8.50E-01 -3.76E-02 -1.32E-01
Multiple myeloma 2A83.1 Peripheral blood 6.40E-01 1.98E-01 2.88E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.58E-01 -2.22E-01 -7.35E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.25E-05 1.66E-01 7.19E-01
Myelofibrosis 2A20.2 Whole blood 2.08E-01 -7.23E-02 -6.37E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.08E-01 -1.34E-01 -1.95E-01
Myopathy 8C70.6 Muscle tissue 3.49E-06 3.95E-01 3.33E+00
Neonatal sepsis KA60 Whole blood 5.49E-03 -9.30E-02 -5.22E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.20E-02 1.29E-01 5.32E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 3.77E-03 7.26E-01 1.84E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.69E-01 -9.54E-02 -3.51E-01
Olive pollen allergy CA08.00 Peripheral blood 1.38E-01 -3.25E-01 -7.54E-01
Oral cancer 2B6E Oral tissue 3.21E-09 5.59E-01 1.60E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.63E-02 4.89E-01 7.48E-01
Osteoporosis FB83.1 Bone marrow 5.08E-01 2.85E-03 8.21E-03
Ovarian cancer 2C73 Ovarian tissue 7.68E-06 8.29E-01 2.68E+00
Pancreatic cancer 2C10 Pancreas 3.14E-01 2.73E-02 3.04E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 2.30E-01 -1.35E-01 -6.11E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.12E-01 -2.83E-02 -1.80E-01
Pituitary cancer 2D12 Pituitary tissue 2.36E-01 -2.90E-01 -5.48E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.11E-01 -1.32E-01 -3.09E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.64E-01 5.58E-03 3.75E-02
Polycythemia vera 2A20.4 Whole blood 7.88E-01 2.47E-02 1.72E-01
Pompe disease 5C51.3 Biceps muscle 7.13E-01 2.07E-02 5.06E-02
Preterm birth KA21.4Z Myometrium 4.33E-02 2.12E-01 4.21E-01
Prostate cancer 2C82 Prostate 1.24E-02 7.17E-01 9.46E-01
Psoriasis EA90 Skin 2.21E-01 -1.03E-01 -2.30E-01
Rectal cancer 2B92 Rectal colon tissue 1.92E-05 -1.04E+00 -3.86E+00
Renal cancer 2C90-2C91 Kidney 2.27E-07 1.34E+00 3.15E+00
Retinoblastoma 2D02.2 Uvea 5.17E-04 4.17E-01 4.28E+00
Rheumatoid arthritis FA20 Synovial tissue 3.42E-02 4.11E-01 6.40E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.52E-01 7.29E-02 2.93E-01
Schizophrenia 6A20 Prefrontal cortex 1.24E-02 -1.58E-01 -3.76E-01
Schizophrenia 6A20 Superior temporal cortex 1.59E-01 -6.39E-02 -4.27E-01
Scleroderma 4A42.Z Whole blood 9.40E-01 -5.18E-03 -4.40E-02
Seizure 8A60-8A6Z Whole blood 5.81E-01 -4.19E-02 -3.00E-01
Sensitive skin EK0Z Skin 4.38E-01 -2.31E-01 -5.32E-01
Sepsis with septic shock 1G41 Whole blood 7.26E-17 -2.15E-01 -1.16E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.85E-02 5.52E-01 1.37E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.16E-01 1.02E-01 7.59E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.18E-01 -2.08E-02 -7.11E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.36E-01 8.94E-02 3.19E-01
Skin cancer 2C30-2C3Z Skin 5.00E-07 2.23E-01 3.96E-01
Thrombocythemia 3B63 Whole blood 3.03E-02 3.68E-02 3.16E-01
Thrombocytopenia 3B64 Whole blood 9.20E-01 7.52E-02 1.73E-01
Thyroid cancer 2D10 Thyroid 9.11E-03 8.42E-02 2.53E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.52E-05 3.26E-01 1.88E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.22E-01 -1.20E-01 -9.44E-01
Type 2 diabetes 5A11 Liver tissue 3.81E-01 6.85E-01 8.29E-01
Ureter cancer 2C92 Urothelium 4.08E-01 1.51E-02 1.02E-01
Uterine cancer 2C78 Endometrium tissue 2.91E-04 2.11E-01 3.10E-01
Vitiligo ED63.0 Skin 3.62E-01 -1.26E-01 -2.66E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases