Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTJCWP8)

DTP Name Mitochondrial glutamate carrier 1 (SLC25A22)
Gene Name SLC25A22
UniProt ID
Q9H936 (GHC1_HUMAN)
VARIDT ID
DTD0183
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms EIEE3; GC-1; GC1; Glutamate/H(+) symporter 1; NET44; SLC25A22; Solute carrier family 25 member 22
DTP Family Mitochondrial Carrier (MC) Family ;
Tissue Specificity Highly expressed in most tissues.
Sequence
MADKQISLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRVYTSMSDCLIKTVRSE
GYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV
TTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRS
RGIAGLYKGLGATLLRDVPFSVVYFPLFANLNQLGRPASEEKSPFYVSFLAGCVAGSAAA
VAVNPCDVVKTRLQSLQRGVNEDTYSGILDCARKILRHEGPSAFLKGAYCRALVIAPLFG
IAQVVYFLGIAESLLGLLQDPQA
Function This transporter involved in the transport of glutamate across the inner mitochondrial membrane.
Endogenous Substrate(s) H+
TCDB ID
2.A.29.14.3
Gene ID
79751
Reactome Pathway
Organic anion transporters (R-HSA-428643 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-Glutamic Acid DM4PUDW Schizophrenia 6A20 Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.00E-10 2.03E-01 7.28E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.98E-01 2.12E-01 5.87E-01
Alopecia ED70 Skin from scalp 2.41E-01 2.48E-02 8.45E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.35E-09 -4.19E-01 -9.19E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.86E-01 -1.90E-02 -1.29E-01
Aortic stenosis BB70 Calcified aortic valve 4.60E-01 3.36E-02 7.31E-02
Apnea 7A40 Hyperplastic tonsil 8.37E-01 -5.33E-02 -2.15E-01
Arthropathy FA00-FA5Z Peripheral blood 1.91E-01 -6.86E-02 -4.82E-01
Asthma CA23 Nasal and bronchial airway 8.39E-01 -4.39E-02 -9.22E-02
Atopic dermatitis EA80 Skin 7.65E-10 4.57E-01 2.22E+00
Autism 6A02 Whole blood 7.30E-01 -1.15E-02 -5.29E-02
Autoimmune uveitis 9A96 Peripheral monocyte 8.99E-01 3.40E-02 1.47E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.83E-01 4.84E-02 2.81E-01
Bacterial infection of gingival 1C1H Gingival tissue 8.32E-01 -7.99E-03 -2.44E-02
Batten disease 5C56.1 Whole blood 3.18E-01 -1.41E-01 -7.75E-01
Behcet's disease 4A62 Peripheral blood 2.86E-01 6.37E-02 1.98E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.20E-01 -6.42E-02 -2.41E-01
Bladder cancer 2C94 Bladder tissue 6.96E-05 4.48E-01 2.61E+00
Breast cancer 2C60-2C6Z Breast tissue 9.86E-97 5.84E-01 1.88E+00
Cardioembolic stroke 8B11.20 Whole blood 2.68E-03 -2.30E-01 -9.14E-01
Cervical cancer 2C77 Cervical tissue 2.90E-01 -1.10E-02 -5.81E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.30E-01 1.17E-01 4.41E-01
Chronic hepatitis C 1E51.1 Whole blood 9.23E-01 -1.16E-01 -5.14E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.94E-02 -1.72E-01 -6.34E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.76E-01 -1.01E-01 -3.19E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.02E-02 2.62E-01 1.49E+00
Colon cancer 2B90 Colon tissue 6.94E-29 3.50E-01 1.14E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.05E-01 -1.01E-01 -2.95E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.83E-01 4.40E-02 8.98E-02
Endometriosis GA10 Endometrium tissue 6.15E-01 -1.07E-02 -4.24E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.30E-01 -7.05E-02 -3.52E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.96E-01 8.95E-02 4.95E-01
Gastric cancer 2B72 Gastric tissue 1.88E-01 1.21E-01 4.40E-01
Glioblastopma 2A00.00 Nervous tissue 1.16E-104 -1.42E+00 -1.80E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.24E-03 5.70E-01 1.31E+00
Head and neck cancer 2D42 Head and neck tissue 9.10E-13 2.74E-01 9.08E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.62E-01 1.67E-01 2.45E-01
Huntington's disease 8A01.10 Whole blood 7.36E-01 2.34E-02 7.58E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.84E-01 -1.96E-02 -8.38E-02
Immunodeficiency 4A00-4A20 Peripheral blood 3.71E-02 6.75E-02 4.18E-01
Influenza 1.00E+30 Whole blood 8.21E-01 7.96E-02 9.88E-01
Interstitial cystitis GC00.3 Bladder tissue 7.76E-01 -1.49E-03 -9.41E-03
Intracranial aneurysm 8B01.0 Intracranial artery 9.10E-03 3.09E-01 1.79E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.46E-02 -2.51E-02 -1.30E-01
Ischemic stroke 8B11 Peripheral blood 9.31E-01 3.62E-02 2.07E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.49E-01 5.62E-02 2.49E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.57E-02 3.16E-01 1.14E+00
Lateral sclerosis 8B60.4 Skin 8.22E-01 1.92E-02 9.04E-02
Liver cancer 2C12.0 Liver tissue 3.12E-03 -1.75E-01 -5.58E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.93E-02 -7.13E-01 -1.54E+00
Lung cancer 2C25 Lung tissue 4.10E-26 3.02E-01 9.29E-01
Lupus erythematosus 4A40 Whole blood 1.06E-01 -3.33E-02 -9.15E-02
Major depressive disorder 6A70-6A7Z Whole blood 1.63E-01 1.28E-02 5.67E-02
Major depressive disorder 6A70-6A7Z Hippocampus 5.93E-01 -5.42E-03 -2.00E-02
Melanoma 2C30 Skin 5.73E-01 -4.96E-02 -1.11E-01
Multiple myeloma 2A83.1 Bone marrow 7.97E-02 1.37E-01 5.67E-01
Multiple myeloma 2A83.1 Peripheral blood 2.23E-01 -1.99E-01 -7.22E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.50E-01 1.38E-01 5.87E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.62E-01 -1.60E-01 -4.51E-01
Myelofibrosis 2A20.2 Whole blood 1.90E-04 -8.98E-02 -7.61E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.29E-01 -6.51E-02 -1.45E-01
Myopathy 8C70.6 Muscle tissue 3.01E-01 -1.32E-02 -9.79E-02
Neonatal sepsis KA60 Whole blood 8.40E-10 -3.08E-01 -1.07E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.79E-07 3.98E-01 2.42E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.07E-02 -1.20E-01 -7.37E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.83E-01 -1.66E-03 -5.54E-03
Olive pollen allergy CA08.00 Peripheral blood 3.23E-01 2.87E-01 1.01E+00
Oral cancer 2B6E Oral tissue 9.56E-01 4.68E-02 1.39E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.43E-01 2.15E-02 6.01E-02
Osteoporosis FB83.1 Bone marrow 4.60E-01 1.35E-01 2.92E-01
Ovarian cancer 2C73 Ovarian tissue 1.51E-01 2.73E-01 6.82E-01
Pancreatic cancer 2C10 Pancreas 2.62E-01 4.78E-02 6.37E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 2.84E-01 -1.12E-01 -2.83E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.65E-02 1.35E-01 7.41E-01
Pituitary cancer 2D12 Pituitary tissue 1.58E-02 -2.59E-01 -1.00E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.71E-01 -3.46E-02 -1.05E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.69E-01 1.10E-01 3.89E-01
Polycythemia vera 2A20.4 Whole blood 1.62E-07 -1.33E-01 -9.70E-01
Pompe disease 5C51.3 Biceps muscle 4.37E-01 -5.09E-02 -1.87E-01
Preterm birth KA21.4Z Myometrium 6.22E-01 5.69E-02 2.20E-01
Prostate cancer 2C82 Prostate 5.87E-03 1.41E-01 3.17E-01
Psoriasis EA90 Skin 1.67E-01 -6.47E-03 -1.52E-02
Rectal cancer 2B92 Rectal colon tissue 1.61E-02 2.07E-01 9.17E-01
Renal cancer 2C90-2C91 Kidney 3.41E-01 2.17E-02 1.22E-01
Retinoblastoma 2D02.2 Uvea 5.57E-13 -1.43E+00 -9.74E+00
Rheumatoid arthritis FA20 Synovial tissue 5.16E-01 4.74E-02 1.37E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.88E-01 2.21E-02 1.77E-01
Schizophrenia 6A20 Prefrontal cortex 4.79E-02 -1.75E-01 -2.45E-01
Schizophrenia 6A20 Superior temporal cortex 7.52E-01 2.56E-02 8.98E-02
Scleroderma 4A42.Z Whole blood 2.08E-01 -1.29E-01 -5.93E-01
Seizure 8A60-8A6Z Whole blood 7.61E-01 5.98E-02 3.58E-01
Sensitive skin EK0Z Skin 6.83E-01 4.59E-02 2.36E-01
Sepsis with septic shock 1G41 Whole blood 7.03E-18 -2.46E-01 -9.13E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.29E-01 -1.26E-02 -6.64E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.71E-01 1.30E-01 6.91E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 6.63E-01 5.98E-02 2.95E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.46E-01 -7.57E-02 -1.21E+00
Skin cancer 2C30-2C3Z Skin 1.56E-14 2.98E-01 7.26E-01
Thrombocythemia 3B63 Whole blood 6.15E-06 -1.44E-01 -1.10E+00
Thrombocytopenia 3B64 Whole blood 2.62E-01 6.13E-01 1.26E+00
Thyroid cancer 2D10 Thyroid 3.10E-12 1.58E-01 6.74E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.56E-01 -4.39E-02 -1.93E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.18E-02 -1.01E+00 -7.78E+00
Type 2 diabetes 5A11 Liver tissue 2.25E-01 -5.73E-02 -2.49E-01
Ureter cancer 2C92 Urothelium 8.11E-01 6.12E-02 2.72E-01
Uterine cancer 2C78 Endometrium tissue 7.43E-06 -1.56E-01 -2.84E-01
Vitiligo ED63.0 Skin 7.45E-01 1.06E-02 3.78E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Impaired mitochondrial glutamate transport in autosomal recessive neonatal myoclonic epilepsy. Am J Hum Genet. 2005 Feb;76(2):334-9.