Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTKDTML)

DTP Name Fatty acid transport protein 1 (SLC27A1)
Gene Name SLC27A1
UniProt ID
Q6PCB7 (S27A1_HUMAN)
VARIDT ID
DTD0238
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ACSVL5; FATP; FATP-1; FATP1; Long-chain fatty acid transport protein 1; SLC27A1; Solute carrier family 27 member 1
DTP Family Fatty Acid Transporter (FAT) Family ;
Tissue Specificity Highest levels of expression are detected inmuscle and adipose tissue small, intermediate levels in smallintestine, and barely detectable in liver.
Sequence
MRAPGAGAASVVSLALLWLLGLPWTWSAAAALGVYVGSGGWRFLRIVCKTARRDLFGLSV
LIRVRLELRRHQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLF
RQLGFAPGDVVAIFLEGRPEFVGLWLGLAKAGMEAALLNVNLRREPLAFCLGTSGAKALI
FGGEMVAAVAEVSGHLGKSLIKFCSGDLGPEGILPDTHLLDPLLKEASTAPLAQIPSKGM
DDRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAYRMQAADVLYDCLPLYHSAGNIIG
VGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLKQPVREAERRHRVRL
AVGNGLRPAIWEEFTERFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIR
LVKVNEDTMELLRDAQGLCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSV
FSKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVY
GVAVPGVEGKAGMAAVADPHSLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQ
KTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSGAFAL
Function
This transporter mediates the ATP-dependent import of long-chain fatty acids (LCFA) into the cell by mediating their translocation at the plasma membrane. Has also an acyl-CoA ligase activity for long-chain and very-long-chain fatty acids. May act directly as a bona fide transporter, or alternatively, in a cytoplasmic or membrane-associated multimeric protein complex to trap and draw fatty acids towards accumulation. Plays a pivotal role in regulating available LCFA substrates from exogenous sources in tissues undergoing high levels of beta-oxidation or triglyceride synthesis.
Endogenous Substrate(s) Fatty acids
TCDB ID
4.C.1.1.9
Gene ID
376497
KEGG Pathway
PPAR signaling pathway (hsa03320 )
Insulin resistance (hsa04931 )
Fat digestion and absorption (hsa04975 )
Reactome Pathway
Transport of fatty acids (R-HSA-804914 )
PPARA activates gene expression (R-HSA-1989781 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
OLEIC ACID DM54O1Z Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.10E-31 6.11E-01 1.50E+00
Adrenocortical carcinoma 2D11.Z Kidney 1.43E-01 2.28E-01 6.91E-01
Alopecia ED70 Skin from scalp 1.55E-01 8.88E-02 2.51E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.63E-05 1.92E-01 4.75E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.13E-01 1.90E-01 5.76E-01
Aortic stenosis BB70 Calcified aortic valve 3.62E-01 -7.30E-02 -2.30E-01
Apnea 7A40 Hyperplastic tonsil 8.06E-01 -3.42E-02 -8.19E-02
Arthropathy FA00-FA5Z Peripheral blood 3.50E-01 -4.50E-02 -1.44E-01
Asthma CA23 Nasal and bronchial airway 1.28E-03 3.38E-01 3.06E-01
Atopic dermatitis EA80 Skin 3.83E-04 4.11E-01 1.91E+00
Autism 6A02 Whole blood 9.95E-01 1.82E-02 8.40E-02
Autoimmune uveitis 9A96 Peripheral monocyte 7.22E-01 1.25E-01 2.30E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.98E-01 -7.88E-02 -8.27E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.46E-04 1.37E-01 5.00E-01
Batten disease 5C56.1 Whole blood 7.54E-01 1.08E-02 3.12E-02
Behcet's disease 4A62 Peripheral blood 8.59E-01 -1.71E-02 -7.66E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.06E-01 1.04E-02 5.81E-02
Bladder cancer 2C94 Bladder tissue 4.29E-04 -6.45E-01 -2.27E+00
Breast cancer 2C60-2C6Z Breast tissue 4.75E-57 -6.32E-01 -1.33E+00
Cardioembolic stroke 8B11.20 Whole blood 1.04E-04 -3.75E-01 -1.32E+00
Cervical cancer 2C77 Cervical tissue 3.16E-02 -1.52E-01 -2.41E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.82E-01 1.53E-01 3.97E-01
Chronic hepatitis C 1E51.1 Whole blood 9.56E-01 -4.26E-02 -2.47E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.21E-02 -1.95E-01 -7.54E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.59E-01 -1.22E-02 -2.96E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.57E-01 -1.56E-02 -5.28E-02
Colon cancer 2B90 Colon tissue 3.59E-22 2.22E-01 7.65E-01
Coronary artery disease BA80-BA8Z Peripheral blood 8.82E-01 1.51E-01 3.22E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.25E-01 -9.25E-02 -3.23E-01
Endometriosis GA10 Endometrium tissue 4.56E-01 -2.91E-02 -1.17E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.39E-01 -4.07E-03 -1.96E-02
Familial hypercholesterolemia 5C80.00 Whole blood 2.86E-12 1.03E+00 2.97E+00
Gastric cancer 2B72 Gastric tissue 1.25E-01 -3.16E-01 -1.50E+00
Glioblastopma 2A00.00 Nervous tissue 5.84E-12 -3.41E-01 -5.56E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.44E-01 -1.62E-01 -4.88E-01
Head and neck cancer 2D42 Head and neck tissue 9.79E-14 -5.98E-01 -6.38E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.05E-01 3.26E-01 4.98E-01
Huntington's disease 8A01.10 Whole blood 8.74E-01 1.30E-02 4.97E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.25E-03 6.99E-01 2.29E+00
Immunodeficiency 4A00-4A20 Peripheral blood 9.53E-03 -2.81E-01 -1.35E+00
Influenza 1.00E+30 Whole blood 7.96E-01 1.06E-01 1.24E+00
Interstitial cystitis GC00.3 Bladder tissue 1.03E-01 -1.31E-01 -4.67E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.46E-01 1.56E-01 2.80E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.61E-01 -6.07E-02 -2.33E-01
Ischemic stroke 8B11 Peripheral blood 1.88E-01 -7.08E-03 -2.45E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.73E-07 -2.88E-01 -8.42E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.18E-01 2.52E-01 3.56E-01
Lateral sclerosis 8B60.4 Skin 1.31E-01 -3.42E-01 -1.21E+00
Liver cancer 2C12.0 Liver tissue 2.29E-01 -3.37E-02 -9.39E-02
Liver failure DB99.7-DB99.8 Liver tissue 1.63E-03 6.93E-01 1.76E+00
Lung cancer 2C25 Lung tissue 1.44E-19 -2.57E-01 -8.31E-01
Lupus erythematosus 4A40 Whole blood 7.90E-01 -6.00E-02 -1.12E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.48E-01 -5.70E-03 -1.81E-02
Major depressive disorder 6A70-6A7Z Hippocampus 5.20E-01 -2.97E-02 -1.60E-01
Melanoma 2C30 Skin 9.93E-01 -2.04E-02 -3.91E-02
Multiple myeloma 2A83.1 Bone marrow 4.27E-02 1.91E-01 7.15E-01
Multiple myeloma 2A83.1 Peripheral blood 7.47E-01 3.44E-01 6.97E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.32E-01 -3.62E-03 -1.72E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 6.52E-02 8.76E-03 4.02E-02
Myelofibrosis 2A20.2 Whole blood 8.10E-03 -2.64E-01 -1.92E+00
Myocardial infarction BA41-BA50 Peripheral blood 9.80E-01 1.39E-01 1.97E-01
Myopathy 8C70.6 Muscle tissue 1.03E-01 -3.20E-01 -1.04E+00
Neonatal sepsis KA60 Whole blood 5.56E-01 -2.29E-02 -6.04E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.16E-15 -1.54E+00 -8.82E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.51E-01 3.44E-02 8.48E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.54E-01 -9.73E-02 -2.68E-01
Olive pollen allergy CA08.00 Peripheral blood 2.40E-01 4.26E-01 1.04E+00
Oral cancer 2B6E Oral tissue 3.90E-03 -2.99E-01 -4.84E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.26E-01 5.62E-01 8.93E-01
Osteoporosis FB83.1 Bone marrow 3.87E-03 1.51E+00 2.11E+00
Ovarian cancer 2C73 Ovarian tissue 5.46E-02 -3.48E-01 -7.83E-01
Pancreatic cancer 2C10 Pancreas 1.42E-02 3.66E-01 9.42E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.83E-01 6.02E-02 2.41E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.74E-02 5.83E-02 2.84E-01
Pituitary cancer 2D12 Pituitary tissue 4.78E-01 -8.39E-02 -2.53E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.45E-01 8.72E-02 2.55E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.66E-01 -1.23E-01 -7.43E-01
Polycythemia vera 2A20.4 Whole blood 2.92E-05 -1.10E-01 -6.69E-01
Pompe disease 5C51.3 Biceps muscle 1.81E-02 4.27E-01 9.62E-01
Preterm birth KA21.4Z Myometrium 4.21E-01 1.18E-01 3.44E-01
Prostate cancer 2C82 Prostate 9.42E-05 -2.77E-01 -5.20E-01
Psoriasis EA90 Skin 1.53E-10 -4.00E-01 -9.91E-01
Rectal cancer 2B92 Rectal colon tissue 8.83E-01 -5.39E-02 -3.38E-01
Renal cancer 2C90-2C91 Kidney 2.38E-03 2.04E-01 1.28E+00
Retinoblastoma 2D02.2 Uvea 1.49E-07 1.59E+00 5.49E+00
Rheumatoid arthritis FA20 Synovial tissue 3.96E-04 7.94E-01 2.32E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.73E-02 -1.08E-01 -4.68E-01
Schizophrenia 6A20 Prefrontal cortex 7.08E-01 -2.63E-02 -9.93E-02
Schizophrenia 6A20 Superior temporal cortex 2.45E-01 -2.76E-02 -1.10E-01
Scleroderma 4A42.Z Whole blood 3.62E-04 2.25E-01 1.81E+00
Seizure 8A60-8A6Z Whole blood 1.53E-01 -1.70E-01 -7.00E-01
Sensitive skin EK0Z Skin 1.40E-01 -1.28E-01 -1.01E+00
Sepsis with septic shock 1G41 Whole blood 4.93E-09 -1.77E-01 -6.21E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.13E-01 6.20E-02 5.16E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.84E-01 1.38E-01 6.03E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.85E-01 3.72E-01 8.66E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.04E-02 2.96E-01 3.79E+00
Skin cancer 2C30-2C3Z Skin 3.26E-01 1.78E-01 4.74E-01
Thrombocythemia 3B63 Whole blood 2.98E-05 -1.79E-01 -1.41E+00
Thrombocytopenia 3B64 Whole blood 9.48E-01 1.29E-01 1.05E-01
Thyroid cancer 2D10 Thyroid 1.58E-01 -1.19E-01 -3.26E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.79E-01 -8.30E-02 -1.48E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.29E-02 6.48E-01 3.42E+00
Type 2 diabetes 5A11 Liver tissue 4.28E-01 -3.10E-01 -7.76E-01
Ureter cancer 2C92 Urothelium 5.96E-01 -1.26E-01 -3.47E-01
Uterine cancer 2C78 Endometrium tissue 9.09E-15 -3.90E-01 -5.76E-01
Vitiligo ED63.0 Skin 3.80E-02 -1.63E-01 -1.15E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 The blood-brain barrier fatty acid transport protein 1 (FATP1/SLC27A1) supplies docosahexaenoic acid to the brain, and insulin facilitates transport. J Neurochem. 2017 May;141(3):400-412.