General Information of Drug Transporter (DTP) (ID: DTKLJT4)

DTP Name Magnesium transporter protein 1 (SLC58A1)
Gene Name SLC58A1
UniProt ID
Q9H0U3 (MAGT1_HUMAN)
VARIDT ID
DTD0414
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1; IAG2; IAP; Implantation-associated protein; MRX95; MagT1; OST3B; Oligosaccharyl transferase subunit MAGT1; PRO0756; PSEC0084; SLC58A1; UNQ628/PRO1244; XMEN; bA217H1.1
DTP Family Magnesium Transporter1 (MAGT1) Family ;
Sequence
MAARWRFWCVSVTMVVALLIVCDVPSASAQRKKEMVLSEKVSQLMEWTNKRPVIRMNGDK
FRRLVKAPPRNYSVIVMFTALQLHRQCVVCKQADEEFQILANSWRYSSAFTNRIFFAMVD
FDEGSDVFQMLNMNSAPTFINFPAKGKPKRGDTYELQVRGFSAEQIARWIADRTDVNIRV
IRPPNYAGPLMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFAALCFVLAMTSGQMWNHIR
GPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRK
IMCVAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS
Function
This transporter acts as accessory component of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Involved in N-glycosylation of STT3B-dependent substrates.
Endogenous Substrate(s) Mg2+
TCDB ID
1.A.76.1.1
Gene ID
84061
Reactome Pathway
Miscellaneous transport and binding events (R-HSA-5223345 )
Neutrophil degranulation (R-HSA-6798695 )
Maturation of spike protein (R-HSA-9694548 )
Asparagine N-linked glycosylation (R-HSA-446203 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.68E-08 2.61E-01 6.00E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.26E-01 1.68E-01 3.26E-01
Alopecia ED70 Skin from scalp 5.45E-01 5.10E-03 2.11E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.01E-02 2.79E-01 4.71E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.95E-01 -1.66E-01 -3.69E-01
Aortic stenosis BB70 Calcified aortic valve 1.37E-01 -2.48E-01 -4.32E-01
Apnea 7A40 Hyperplastic tonsil 4.62E-01 8.04E-01 2.20E+00
Arthropathy FA00-FA5Z Peripheral blood 1.75E-01 -3.20E-02 -1.37E-01
Asthma CA23 Nasal and bronchial airway 5.93E-03 1.02E+00 9.55E-01
Atopic dermatitis EA80 Skin 5.17E-01 1.37E-01 3.92E-01
Autism 6A02 Whole blood 1.09E-01 -2.33E-01 -7.58E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.07E-01 -4.45E-01 -1.04E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.76E-03 3.38E-01 1.25E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.67E-02 -1.70E-01 -4.90E-01
Batten disease 5C56.1 Whole blood 1.10E-01 -1.92E-01 -8.06E-01
Behcet's disease 4A62 Peripheral blood 4.24E-01 3.72E-02 1.64E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.81E-01 7.36E-02 1.92E-01
Bladder cancer 2C94 Bladder tissue 1.86E-03 -7.30E-01 -2.26E+00
Breast cancer 2C60-2C6Z Breast tissue 4.93E-35 6.21E-01 1.19E+00
Cardioembolic stroke 8B11.20 Whole blood 2.29E-01 7.78E-02 6.40E-01
Cervical cancer 2C77 Cervical tissue 3.57E-04 4.93E-01 8.46E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.01E-01 -4.52E-02 -7.52E-02
Chronic hepatitis C 1E51.1 Whole blood 2.31E-01 -1.26E-01 -7.02E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.35E-02 -3.22E-01 -6.45E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.35E-01 1.46E-01 3.28E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.29E-04 1.01E+00 1.92E+00
Colon cancer 2B90 Colon tissue 3.79E-05 1.85E-01 4.34E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.72E-03 7.34E-01 2.18E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.93E-01 -8.92E-02 -1.57E-01
Endometriosis GA10 Endometrium tissue 1.82E-02 -8.12E-01 -1.05E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.41E-02 6.14E-02 2.67E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.08E-05 5.13E-01 1.10E+00
Gastric cancer 2B72 Gastric tissue 4.11E-01 6.64E-01 7.14E-01
Glioblastopma 2A00.00 Nervous tissue 3.36E-69 1.22E+00 1.58E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.17E-11 -7.55E-01 -4.63E+00
Head and neck cancer 2D42 Head and neck tissue 1.24E-14 5.52E-01 9.94E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.06E-01 5.48E-01 6.19E-01
Huntington's disease 8A01.10 Whole blood 3.67E-01 -3.27E-01 -7.67E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.14E-02 6.86E-01 4.14E+00
Immunodeficiency 4A00-4A20 Peripheral blood 8.17E-01 6.85E-02 6.81E-01
Influenza 1.00E+30 Whole blood 9.15E-01 1.82E-01 1.32E+00
Interstitial cystitis GC00.3 Bladder tissue 8.66E-01 3.44E-02 3.67E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.75E-02 2.73E-01 1.77E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.41E-03 7.00E-02 5.75E-01
Ischemic stroke 8B11 Peripheral blood 1.87E-01 -5.19E-02 -2.44E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.78E-02 -5.49E-02 -2.86E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.64E-01 2.13E-01 4.43E-01
Lateral sclerosis 8B60.4 Skin 7.97E-01 -6.83E-02 -2.26E-01
Liver cancer 2C12.0 Liver tissue 6.40E-01 4.21E-02 6.82E-02
Liver failure DB99.7-DB99.8 Liver tissue 1.84E-07 -1.28E+00 -5.61E+00
Lung cancer 2C25 Lung tissue 1.54E-03 -1.80E-01 -3.76E-01
Lupus erythematosus 4A40 Whole blood 2.53E-01 -8.19E-02 -7.47E-02
Major depressive disorder 6A70-6A7Z Whole blood 6.57E-01 -2.59E-03 -7.66E-03
Major depressive disorder 6A70-6A7Z Hippocampus 7.75E-01 1.42E-02 3.61E-02
Melanoma 2C30 Skin 2.10E-01 -1.57E-01 -1.73E-01
Multiple myeloma 2A83.1 Bone marrow 1.94E-03 8.40E-01 1.68E+00
Multiple myeloma 2A83.1 Peripheral blood 2.83E-01 -1.58E-01 -9.94E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.89E-02 -3.14E-01 -1.21E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.64E-03 -1.64E-01 -4.68E-01
Myelofibrosis 2A20.2 Whole blood 8.16E-07 4.75E-01 1.41E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.08E-02 -4.67E-01 -3.19E-01
Myopathy 8C70.6 Muscle tissue 1.24E-02 2.73E-01 9.18E-01
Neonatal sepsis KA60 Whole blood 9.18E-02 1.23E-01 2.61E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.51E-01 7.31E-02 2.05E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 3.69E-01 1.33E-01 2.93E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.84E-02 4.32E-01 2.23E+00
Olive pollen allergy CA08.00 Peripheral blood 1.26E-03 -1.14E+00 -3.45E+00
Oral cancer 2B6E Oral tissue 5.23E-04 9.61E-01 1.11E+00
Osteoarthritis FA00-FA0Z Synovial tissue 2.04E-01 3.16E-01 3.21E-01
Osteoporosis FB83.1 Bone marrow 4.90E-02 -3.92E-01 -1.78E+00
Ovarian cancer 2C73 Ovarian tissue 7.45E-02 2.68E-01 5.40E-01
Pancreatic cancer 2C10 Pancreas 3.46E-03 3.38E-01 9.68E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.99E-01 3.64E-01 6.74E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.35E-03 2.18E-01 8.69E-01
Pituitary cancer 2D12 Pituitary tissue 1.35E-02 -8.39E-01 -1.46E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.30E-05 -1.37E+00 -2.34E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.58E-01 3.68E-02 1.46E-01
Polycythemia vera 2A20.4 Whole blood 4.06E-01 1.28E-01 3.72E-01
Pompe disease 5C51.3 Biceps muscle 3.47E-01 -7.14E-02 -4.42E-01
Preterm birth KA21.4Z Myometrium 5.46E-01 -3.67E-01 -4.81E-01
Prostate cancer 2C82 Prostate 9.52E-04 1.10E+00 1.17E+00
Psoriasis EA90 Skin 3.35E-11 4.98E-01 7.66E-01
Rectal cancer 2B92 Rectal colon tissue 2.49E-01 -1.22E-01 -6.98E-01
Renal cancer 2C90-2C91 Kidney 1.01E-02 2.90E-01 1.18E+00
Retinoblastoma 2D02.2 Uvea 1.14E-15 3.10E+00 1.57E+01
Rheumatoid arthritis FA20 Synovial tissue 1.38E-02 7.16E-01 9.41E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.12E-02 1.27E-01 6.59E-01
Schizophrenia 6A20 Prefrontal cortex 9.06E-02 2.41E-01 1.89E-01
Schizophrenia 6A20 Superior temporal cortex 2.54E-01 -4.96E-03 -1.72E-02
Scleroderma 4A42.Z Whole blood 1.49E-02 -3.50E-01 -1.23E+00
Seizure 8A60-8A6Z Whole blood 7.63E-03 4.05E-01 1.24E+00
Sensitive skin EK0Z Skin 9.25E-01 6.41E-02 3.32E-01
Sepsis with septic shock 1G41 Whole blood 7.22E-07 2.99E-01 6.66E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.67E-01 -4.78E-02 -1.94E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.96E-01 -1.59E-01 -6.92E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.98E-01 -2.01E-02 -1.52E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.60E-01 8.87E-01 2.02E+00
Skin cancer 2C30-2C3Z Skin 5.75E-10 5.44E-01 5.97E-01
Thrombocythemia 3B63 Whole blood 2.57E-02 2.88E-01 8.42E-01
Thrombocytopenia 3B64 Whole blood 2.79E-01 -1.05E+00 -9.72E-01
Thyroid cancer 2D10 Thyroid 3.97E-17 -5.91E-01 -1.16E+00
Tibial muscular dystrophy 8C75 Muscle tissue 9.27E-05 6.72E-01 2.53E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.44E-02 9.52E-01 1.85E+00
Type 2 diabetes 5A11 Liver tissue 7.30E-01 1.64E-01 2.89E-01
Ureter cancer 2C92 Urothelium 7.83E-01 -9.66E-02 -3.57E-01
Uterine cancer 2C78 Endometrium tissue 3.70E-02 8.53E-02 1.29E-01
Vitiligo ED63.0 Skin 8.59E-01 1.42E-02 2.77E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases