Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTKLMH6)

DTP Name Cystine/glutamate transporter (SLC7A11)
Gene Name SLC7A11
UniProt ID
Q9UPY5 (XCT_HUMAN)
VARIDT ID
DTD0464
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms Amino acid transport system xc-; CCBR1; Calcium channel blocker resistance protein CCBR1; SLC7A11; Solute carrier family 7 member 11; xCT
DTP Family Amino Acid-Polyamine-Organocation (APC) Family
L-type Amino Acid Transporter (LAT) Family
Sequence
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGA
GIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGP
LPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLN
SMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFY
YGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLS
NAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHV
RKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRP
FKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIM
SEKITRTLQIILEVVPEEDKL
Function This sodium-independent, high-affinity transporter is high specificity for anionic form of cystine and glutamate.
Endogenous Substrate(s) Cystine
TCDB ID
2.A.3.8.18
Gene ID
23657
KEGG Pathway
Ferroptosis (hsa04216 )
Reactome Pathway
Amino acid transport across the plasma membrane (R-HSA-352230 )
Nuclear events mediated by NFE2L2 (R-HSA-9759194 )
Basigin interactions (R-HSA-210991 )
BioCyc Pathway
MetaCyc:ENSG00000151012-MON

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-Glutamic Acid DM4PUDW Schizophrenia 6A20 Approved [2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.86E-07 1.49E-01 4.12E-01
Adrenocortical carcinoma 2D11.Z Kidney 7.51E-06 9.15E-02 4.72E-01
Alopecia ED70 Skin from scalp 1.34E-10 -1.17E+00 -1.62E+00
Alzheimer's disease 8A20 Entorhinal cortex 6.50E-05 2.48E-01 3.25E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.32E-01 -5.23E-01 -8.58E-01
Aortic stenosis BB70 Calcified aortic valve 4.87E-01 1.45E-01 2.72E-01
Apnea 7A40 Hyperplastic tonsil 6.35E-02 -4.63E-01 -6.67E-01
Arthropathy FA00-FA5Z Peripheral blood 2.36E-01 6.09E-02 3.79E-01
Asthma CA23 Nasal and bronchial airway 2.63E-07 1.43E+00 1.02E+00
Atopic dermatitis EA80 Skin 3.17E-01 -2.70E-02 -1.16E-01
Autism 6A02 Whole blood 4.51E-01 -5.51E-02 -2.99E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.53E-01 5.32E-02 7.26E-02
Autosomal dominant monocytopenia 4B04 Whole blood 1.95E-01 2.47E+00 1.76E+00
Bacterial infection of gingival 1C1H Gingival tissue 4.08E-10 8.33E-01 1.12E+00
Batten disease 5C56.1 Whole blood 7.83E-01 -8.20E-02 -6.00E-01
Behcet's disease 4A62 Peripheral blood 3.59E-01 -1.34E-01 -5.56E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.90E-01 3.02E-01 6.48E-01
Bladder cancer 2C94 Bladder tissue 6.20E-03 3.85E-01 8.97E-01
Breast cancer 2C60-2C6Z Breast tissue 5.24E-106 4.00E-01 1.69E+00
Cardioembolic stroke 8B11.20 Whole blood 1.40E-05 5.51E-01 1.22E+00
Cervical cancer 2C77 Cervical tissue 9.34E-01 -1.63E-01 -4.94E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.01E-01 -3.01E-02 -1.17E-01
Chronic hepatitis C 1E51.1 Whole blood 7.44E-01 4.98E-02 9.95E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 1.05E-01 2.68E-01 4.47E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.45E-06 2.61E+00 1.51E+00
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.24E-01 3.04E-01 2.67E+00
Colon cancer 2B90 Colon tissue 7.51E-84 1.88E+00 2.77E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.55E-01 -6.11E-02 -1.49E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.75E-01 -5.88E-01 -7.22E-01
Endometriosis GA10 Endometrium tissue 8.48E-01 1.94E-01 9.41E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.42E-01 -5.76E-02 -4.14E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.14E-02 -1.56E-01 -8.97E-01
Gastric cancer 2B72 Gastric tissue 8.67E-01 -5.88E-01 -2.96E-01
Glioblastopma 2A00.00 Nervous tissue 3.57E-01 8.51E-02 9.16E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.79E-01 4.88E-01 4.18E-01
Head and neck cancer 2D42 Head and neck tissue 6.96E-10 1.42E+00 9.56E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.35E-01 1.54E-01 4.15E-01
Huntington's disease 8A01.10 Whole blood 1.93E-01 -9.48E-02 -7.99E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.01E-03 -2.64E+00 -2.14E+00
Immunodeficiency 4A00-4A20 Peripheral blood 4.37E-02 2.39E-01 1.87E+00
Influenza 1.00E+30 Whole blood 1.41E-02 -2.15E+00 -3.47E+00
Interstitial cystitis GC00.3 Bladder tissue 1.38E-02 7.96E-01 2.64E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.13E-05 3.31E+00 1.62E+01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.56E-01 -8.02E-03 -2.14E-02
Ischemic stroke 8B11 Peripheral blood 5.92E-01 -2.12E-02 -1.84E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 6.88E-01 1.09E-02 4.24E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 8.35E-01 2.99E-01 2.89E-01
Lateral sclerosis 8B60.4 Skin 5.21E-01 -8.52E-01 -5.69E-01
Liver cancer 2C12.0 Liver tissue 5.61E-49 9.56E-01 4.79E+00
Liver failure DB99.7-DB99.8 Liver tissue 9.17E-03 4.67E-01 2.07E+00
Lung cancer 2C25 Lung tissue 4.20E-53 1.09E+00 1.19E+00
Lupus erythematosus 4A40 Whole blood 7.87E-01 3.53E-02 5.92E-02
Major depressive disorder 6A70-6A7Z Whole blood 4.44E-03 1.47E-01 5.25E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.30E-01 -1.07E-01 -2.32E-01
Melanoma 2C30 Skin 9.32E-01 3.71E-01 1.88E-01
Multiple myeloma 2A83.1 Bone marrow 1.97E-07 3.33E-01 2.53E+00
Multiple myeloma 2A83.1 Peripheral blood 8.53E-01 -5.40E-01 -6.08E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.01E-01 1.99E-01 5.69E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.68E-01 5.60E-02 2.87E-01
Myelofibrosis 2A20.2 Whole blood 4.55E-01 -8.73E-02 -8.87E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.71E-01 1.36E-01 2.84E-01
Myopathy 8C70.6 Muscle tissue 1.20E-02 1.35E-01 1.15E+00
Neonatal sepsis KA60 Whole blood 6.16E-06 9.44E-02 4.62E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.45E-14 -2.55E+00 -5.89E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 6.93E-01 -2.32E-02 -1.94E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.93E-01 -1.70E-01 -2.09E-01
Olive pollen allergy CA08.00 Peripheral blood 3.55E-02 -1.09E+00 -1.97E+00
Oral cancer 2B6E Oral tissue 1.79E-03 8.13E-01 6.15E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.27E-01 -3.85E-02 -1.76E-02
Osteoporosis FB83.1 Bone marrow 7.26E-01 -7.36E-01 -7.11E-01
Ovarian cancer 2C73 Ovarian tissue 2.27E-01 2.63E-01 2.09E-01
Pancreatic cancer 2C10 Pancreas 6.61E-11 8.94E-01 2.29E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 2.84E-01 -1.03E-01 -1.60E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.03E-01 8.02E-02 6.13E-01
Pituitary cancer 2D12 Pituitary tissue 3.31E-02 2.38E-01 5.72E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.77E-02 4.05E-01 9.61E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.65E-01 1.83E-02 1.56E-01
Polycythemia vera 2A20.4 Whole blood 3.82E-05 9.00E-02 8.00E-01
Pompe disease 5C51.3 Biceps muscle 9.21E-01 8.13E-02 1.56E-01
Preterm birth KA21.4Z Myometrium 9.70E-01 6.74E-02 4.00E-01
Prostate cancer 2C82 Prostate 2.46E-02 3.80E-01 4.28E-01
Psoriasis EA90 Skin 4.15E-36 1.23E+00 2.15E+00
Rectal cancer 2B92 Rectal colon tissue 2.33E-04 1.52E+00 2.97E+00
Renal cancer 2C90-2C91 Kidney 4.79E-11 6.62E-01 2.11E+00
Retinoblastoma 2D02.2 Uvea 4.98E-04 -1.25E+00 -3.11E+00
Rheumatoid arthritis FA20 Synovial tissue 4.16E-04 3.53E-02 1.40E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.32E-01 -9.45E-02 -1.68E-01
Schizophrenia 6A20 Prefrontal cortex 2.22E-01 -1.85E-01 -1.12E-01
Schizophrenia 6A20 Superior temporal cortex 9.72E-01 1.31E-01 3.09E-01
Scleroderma 4A42.Z Whole blood 3.80E-02 1.50E-01 7.80E-01
Seizure 8A60-8A6Z Whole blood 8.61E-01 -2.09E-02 -4.87E-02
Sensitive skin EK0Z Skin 7.04E-02 1.85E-01 1.15E+00
Sepsis with septic shock 1G41 Whole blood 6.42E-26 2.36E-01 9.65E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.95E-01 8.40E-03 2.43E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.93E-02 2.13E-01 1.46E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.49E-01 1.06E+00 7.95E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.26E-01 4.79E-02 1.22E-01
Skin cancer 2C30-2C3Z Skin 3.27E-28 6.65E-01 1.21E+00
Thrombocythemia 3B63 Whole blood 9.66E-02 8.15E-02 8.53E-01
Thrombocytopenia 3B64 Whole blood 2.75E-01 -3.15E-02 -1.35E-01
Thyroid cancer 2D10 Thyroid 3.71E-02 -2.14E-01 -2.78E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.71E-01 -4.42E-02 -3.09E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.85E-02 6.76E-01 1.31E+00
Type 2 diabetes 5A11 Liver tissue 3.89E-02 7.36E-02 1.24E+00
Ureter cancer 2C92 Urothelium 2.18E-01 -2.72E-02 -8.55E-02
Uterine cancer 2C78 Endometrium tissue 4.52E-23 3.78E-01 1.01E+00
Vitiligo ED63.0 Skin 7.84E-01 -1.13E-02 -1.23E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Cystine/glutamate transporter (SLC7A11) DTT Info
DTP DTT Type Clinical trial
1 Clinical Trial Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
SXC-2023 DMZV27P Trichotillomania 6B25.0 Phase 2 [1]
------------------------------------------------------------------------------------

References

1 Clinical pipeline report, company report or official report of Promentis Pharmaceuticals.
2 The glutamate/cystine antiporter SLC7A11/xCT enhances cancer cell dependency on glucose by exporting glutamate. J Biol Chem. 2017 Aug 25;292(34):14240-14249.