Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTKRWE8)

DTP Name Sodium/potassium/calcium exchanger 2 (SLC24A2)
Gene Name SLC24A2
UniProt ID
Q9UI40 (NCKX2_HUMAN)
VARIDT ID
DTD0163
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms NCKX2; Na(+)/K(+)/Ca(2+)-exchange protein 2; Retinal cone Na-Ca+K exchanger; SLC24A2; Solute carrier family 24 member 2
DTP Family Ca(2+):Cation Antiporter (CACA) Family ;
Sequence
MDLQQSTTITSLEKWCLDESLSGCRRHYSVKKKLKLIRVLGLFMGLVAISTVSFSISAFS
ETDTQSTGEASVVSGPRVAQGYHQRTLLDLNDKILDYTPQPPLSKEGESENSTDHAQGDY
PKDIFSLEERRKGAIILHVIGMIYMFIALAIVCDEFFVPSLTVITEKLGISDDVAGATFM
AAGGSAPELFTSLIGVFIAHSNVGIGTIVGSAVFNILFVIGMCALFSREILNLTWWPLFR
DVSFYIVDLIMLIIFFLDNVIMWWESLLLLTAYFCYVVFMKFNVQVEKWVKQMINRNKVV
KVTAPEAQAKPSAARDKDEPTLPAKPRLQRGGSSASLHNSLMRNSIFQLMIHTLDPLAEE
LGSYGKLKYYDTMTEEGRFREKASILHKIAKKKCHVDENERQNGAANHVEKIELPNSTST
DVEMTPSSDASEPVQNGNLSHNIEGAEAQTADEEEDQPLSLAWPSETRKQVTFLIVFPIV
FPLWITLPDVRKPSSRKFFPITFFGSITWIAVFSYLMVWWAHQVGETIGISEEIMGLTIL
AAGTSIPDLITSVIVARKGLGDMAVSSSVGSNIFDITVGLPLPWLLYTVIHRFQPVAVSS
NGLFCAIVLLFIMLLFVILSIALCKWRMNKILGFIMFGLYFVFLVVSVLLEDRILTCPVS
I
Function
This transporter mediates the extrusion of one Ca2+ ion and one K+ ion in exchange for four Na+ ions. This family member is a retinal cone/brain exchanger that can mediate a light-induced decrease in free Ca2+ concentration. This protein may also play a neuroprotective role during ischemic brain injury. Alternative splicing results in multiple transcript variants.
Endogenous Substrate(s) Ca2+; K+; Na+
TCDB ID
2.A.19.4.11
Gene ID
25769
Reactome Pathway
Sodium/Calcium exchangers (R-HSA-425561 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.34E-03 4.48E-02 2.34E-01
Adrenocortical carcinoma 2D11.Z Kidney 9.59E-03 -5.52E-01 -4.90E-01
Alopecia ED70 Skin from scalp 1.49E-03 -1.78E-01 -6.12E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.38E-01 -1.47E-01 -2.66E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.65E-01 -4.68E-02 -3.25E-01
Aortic stenosis BB70 Calcified aortic valve 8.65E-01 7.72E-02 1.24E-01
Apnea 7A40 Hyperplastic tonsil 3.78E-01 -4.28E-02 -1.49E-01
Arthropathy FA00-FA5Z Peripheral blood 4.09E-01 3.97E-02 2.96E-01
Asthma CA23 Nasal and bronchial airway 6.07E-01 5.71E-03 1.64E-02
Atopic dermatitis EA80 Skin 3.63E-01 -8.18E-02 -5.44E-01
Autism 6A02 Whole blood 9.21E-02 -7.40E-02 -4.58E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.36E-02 -1.85E-01 -1.24E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.70E-01 -2.16E-02 -2.65E-01
Bacterial infection of gingival 1C1H Gingival tissue 8.79E-01 5.05E-02 1.48E-01
Batten disease 5C56.1 Whole blood 6.69E-01 -5.97E-02 -5.29E-01
Behcet's disease 4A62 Peripheral blood 7.99E-01 4.55E-02 2.88E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.68E-01 -1.65E-01 -4.30E-01
Bladder cancer 2C94 Bladder tissue 2.73E-04 8.19E-01 2.54E+00
Breast cancer 2C60-2C6Z Breast tissue 5.92E-41 2.60E-01 8.02E-01
Cardioembolic stroke 8B11.20 Whole blood 1.57E-06 1.63E-01 1.61E+00
Cervical cancer 2C77 Cervical tissue 1.96E-01 -2.04E-02 -9.05E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.70E-01 3.20E-02 1.55E-01
Chronic hepatitis C 1E51.1 Whole blood 1.46E-01 1.66E-01 7.32E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.15E-02 1.52E-01 6.65E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.12E-01 -1.78E-02 -1.13E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.05E-01 3.40E-02 3.15E-01
Colon cancer 2B90 Colon tissue 3.67E-14 8.84E-02 4.42E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.74E-01 -6.11E-02 -4.95E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.30E-01 -7.00E-02 -2.11E-01
Endometriosis GA10 Endometrium tissue 9.57E-02 3.11E-02 1.31E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.09E-02 -4.54E-02 -3.52E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.12E-03 -2.01E-01 -8.19E-01
Gastric cancer 2B72 Gastric tissue 3.22E-01 4.33E-02 1.74E-01
Glioblastopma 2A00.00 Nervous tissue 1.71E-203 -2.24E+00 -2.78E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.43E-07 -1.60E+00 -2.99E+00
Head and neck cancer 2D42 Head and neck tissue 5.49E-08 1.35E-01 6.39E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.79E-02 -1.74E-01 -7.93E-01
Huntington's disease 8A01.10 Whole blood 2.22E-01 8.64E-02 7.65E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.35E-01 2.28E-01 8.03E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.15E-02 7.92E-02 1.15E+00
Influenza 1.00E+30 Whole blood 5.64E-01 6.15E-02 6.46E-01
Interstitial cystitis GC00.3 Bladder tissue 9.60E-01 -2.84E-02 -3.05E-01
Intracranial aneurysm 8B01.0 Intracranial artery 9.15E-01 1.63E-02 1.36E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.28E-01 2.18E-01 5.91E-01
Ischemic stroke 8B11 Peripheral blood 1.02E-01 1.05E-01 5.97E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.71E-02 2.91E-02 1.61E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.98E-01 -2.70E-01 -8.32E-01
Lateral sclerosis 8B60.4 Skin 5.21E-01 1.03E-01 9.67E-01
Liver cancer 2C12.0 Liver tissue 3.82E-04 -1.31E-01 -6.48E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.96E-01 1.06E-01 5.74E-01
Lung cancer 2C25 Lung tissue 5.93E-47 2.28E-01 1.18E+00
Lupus erythematosus 4A40 Whole blood 2.50E-03 -1.32E-01 -2.71E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.13E-01 -1.96E-03 -1.19E-02
Major depressive disorder 6A70-6A7Z Hippocampus 7.52E-01 -5.13E-02 -1.40E-01
Melanoma 2C30 Skin 4.67E-02 8.75E-01 9.74E-01
Multiple myeloma 2A83.1 Bone marrow 2.00E-03 -4.36E-01 -1.62E+00
Multiple myeloma 2A83.1 Peripheral blood 1.59E-01 1.95E-01 9.40E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.03E-01 2.24E-02 7.39E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.20E-01 -5.08E-03 -2.20E-02
Myelofibrosis 2A20.2 Whole blood 1.97E-05 1.85E-01 1.32E+00
Myocardial infarction BA41-BA50 Peripheral blood 9.54E-02 3.60E-01 5.86E-01
Myopathy 8C70.6 Muscle tissue 2.28E-03 3.15E-01 2.66E+00
Neonatal sepsis KA60 Whole blood 9.43E-01 -4.06E-02 -1.70E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.06E-18 -2.81E+00 -9.66E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.37E-01 -9.18E-02 -7.26E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.33E-01 7.03E-02 5.77E-01
Olive pollen allergy CA08.00 Peripheral blood 1.71E-01 1.82E-01 7.23E-01
Oral cancer 2B6E Oral tissue 3.89E-01 -1.05E-01 -2.80E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.68E-01 -2.43E-02 -1.82E-01
Osteoporosis FB83.1 Bone marrow 7.77E-02 2.12E-01 1.55E+00
Ovarian cancer 2C73 Ovarian tissue 4.84E-01 -1.42E-01 -8.27E-01
Pancreatic cancer 2C10 Pancreas 9.93E-01 -1.08E-01 -3.60E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.45E-01 4.38E-01 8.47E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.33E-01 -5.76E-02 -6.43E-01
Pituitary cancer 2D12 Pituitary tissue 1.21E-10 1.28E+00 3.47E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.77E-08 1.37E+00 3.38E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.27E-02 8.22E-02 1.23E+00
Polycythemia vera 2A20.4 Whole blood 3.61E-08 2.03E-01 1.55E+00
Pompe disease 5C51.3 Biceps muscle 1.08E-03 1.44E+00 9.39E+00
Preterm birth KA21.4Z Myometrium 3.67E-01 9.72E-02 4.56E-01
Prostate cancer 2C82 Prostate 6.56E-04 -9.01E-01 -1.48E+00
Psoriasis EA90 Skin 2.10E-13 -2.29E-01 -7.26E-01
Rectal cancer 2B92 Rectal colon tissue 4.44E-01 -9.42E-02 -1.03E+00
Renal cancer 2C90-2C91 Kidney 3.61E-01 -1.27E-01 -4.66E-01
Retinoblastoma 2D02.2 Uvea 1.61E-09 -3.36E+00 -9.99E+00
Rheumatoid arthritis FA20 Synovial tissue 1.07E-01 -2.80E-02 -1.90E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.09E-01 1.58E-02 1.09E-01
Schizophrenia 6A20 Prefrontal cortex 6.50E-02 -2.04E-01 -1.07E-01
Schizophrenia 6A20 Superior temporal cortex 3.46E-01 -1.79E-01 -4.93E-01
Scleroderma 4A42.Z Whole blood 6.42E-01 -1.37E-01 -7.86E-01
Seizure 8A60-8A6Z Whole blood 1.78E-01 -1.32E-01 -8.43E-01
Sensitive skin EK0Z Skin 1.21E-01 -4.48E-02 -3.51E-01
Sepsis with septic shock 1G41 Whole blood 1.55E-02 7.48E-02 2.94E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.75E-02 6.37E-01 1.32E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.29E-01 4.55E-02 2.43E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.95E-01 -3.72E-02 -1.40E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.26E-01 7.20E-02 4.90E-01
Skin cancer 2C30-2C3Z Skin 3.92E-05 -5.31E-02 -1.21E-01
Thrombocythemia 3B63 Whole blood 4.50E-03 1.02E-01 6.92E-01
Thrombocytopenia 3B64 Whole blood 5.07E-01 1.63E-01 1.29E+00
Thyroid cancer 2D10 Thyroid 3.07E-02 2.34E-02 9.67E-02
Tibial muscular dystrophy 8C75 Muscle tissue 1.48E-03 2.41E-01 1.15E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.54E-01 -2.10E-01 -1.01E+00
Type 2 diabetes 5A11 Liver tissue 6.36E-01 1.84E-01 4.98E-01
Ureter cancer 2C92 Urothelium 8.64E-01 -5.56E-02 -4.60E-01
Uterine cancer 2C78 Endometrium tissue 8.65E-01 -3.52E-02 -1.05E-01
Vitiligo ED63.0 Skin 2.73E-01 -3.74E-02 -5.43E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases