Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTKS517)

DTP Name Sodium-dependent phosphate transport protein 2C (SLC34A3)
Gene Name SLC34A3
UniProt ID
Q8N130 (NPT2C_HUMAN)
VARIDT ID
DTD0286
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms
HHRH; NPT2C; NPTIIC; Na(+)-dependent phosphate cotransporter 2C; Na(+)/Pi cotransporter 2C; NaPi-2c; SLC34A3; Sodium-phosphate transport protein 2C; Sodium/inorganic phosphate cotransporter IIC; Sodium/phosphate cotransporter 2C; Solute carrier family 34 member 3
DTP Family Phosphate:Na(+) Symporter (PNAS) Family ;
Sequence
MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKEL
RVAGRLRRVAGSVLKACGLLGSLYFFICSLDVLSSAFQLLGSKVAGDIFKDNVVLSNPVA
GLVIGVLVTALVQSSSTSSSIVVSMVAAKLLTVRVSVPIIMGVNVGTSITSTLVSMAQSG
DRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASLTPRAQAPDILK
VLTKPLTHLIVQLDSDMIMSSATGNATNSSLIKHWCGTTGQPTQENSSCGAFGPCTEKNS
TAPADRLPCRHLFAGTELTDLAVGCILLAGSLLVLCGCLVLIVKLLNSVLRGRVAQVVRT
VINADFPFPLGWLGGYLAVLAGAGLTFALQSSSVFTAAVVPLMGVGVISLDRAYPLLLGS
NIGTTTTALLAALASPADRMLSALQVALIHFFFNLAGILLWYLVPALRLPIPLARHFGVV
TARYRWVAGVYLLLGFLLLPLAAFGLSLAGGMELAAVGGPLVGLVLLVILVTVLQRRRPA
WLPVRLRSWAWLPVWLHSLEPWDRLVTRCCPCNVCSPPKATTKEAYCYENPEILASQQL
Function This transporter may be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane. Mediates 20-30% of the apical influx.
Endogenous Substrate(s) Na+
TCDB ID
2.A.58.1.3
Gene ID
142680
KEGG Pathway
Parathyroid hormone synthesis, secretion and action (hsa04928 )
Mineral absorption (hsa04978 )
Reactome Pathway
Defective SLC34A3 causes Hereditary hypophosphatemic rickets with hypercalciuria (HHRH) (R-HSA-5619097 )
Type II Na+/Pi cotransporters (R-HSA-427589 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Calcium phosphate dihydrate DMJ3CFY N. A. N. A. Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.76E-01 -5.34E-02 -2.27E-01
Adrenocortical carcinoma 2D11.Z Kidney 7.48E-02 -1.06E-01 -4.60E-01
Alopecia ED70 Skin from scalp 2.88E-03 -9.46E-02 -5.89E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.97E-02 -1.98E-02 -1.48E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.90E-01 -7.22E-02 -9.88E-01
Aortic stenosis BB70 Calcified aortic valve 3.05E-01 -2.57E-02 -1.00E-01
Apnea 7A40 Hyperplastic tonsil 9.32E-01 -3.68E-02 -1.46E-01
Arthropathy FA00-FA5Z Peripheral blood 1.64E-01 3.10E-02 3.40E-01
Asthma CA23 Nasal and bronchial airway 6.21E-01 -8.62E-03 -1.56E-02
Atopic dermatitis EA80 Skin 4.49E-01 -2.99E-02 -2.39E-01
Autism 6A02 Whole blood 1.88E-01 -1.99E-02 -9.57E-02
Autoimmune uveitis 9A96 Peripheral monocyte 7.30E-03 -2.97E-01 -2.26E+00
Autosomal dominant monocytopenia 4B04 Whole blood 6.92E-01 -1.91E-02 -1.47E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.26E-02 5.96E-02 2.52E-01
Batten disease 5C56.1 Whole blood 1.58E-01 9.30E-02 1.09E+00
Behcet's disease 4A62 Peripheral blood 1.09E-01 8.44E-02 5.38E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.42E-02 -4.91E-02 -3.97E-01
Bladder cancer 2C94 Bladder tissue 1.09E-04 4.95E-01 3.01E+00
Breast cancer 2C60-2C6Z Breast tissue 1.65E-15 -1.36E-01 -4.84E-01
Cardioembolic stroke 8B11.20 Whole blood 5.40E-03 1.22E-01 7.00E-01
Cervical cancer 2C77 Cervical tissue 2.80E-04 -1.09E-01 -9.03E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.52E-01 7.81E-02 2.94E-01
Chronic hepatitis C 1E51.1 Whole blood 6.60E-01 2.96E-02 2.26E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.23E-02 1.24E-01 5.74E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.50E-01 -1.16E-02 -5.90E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.71E-01 -1.82E-02 -1.75E-01
Colon cancer 2B90 Colon tissue 3.48E-05 -6.31E-02 -2.98E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.73E-01 -4.51E-02 -4.44E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.22E-01 -1.74E-01 -1.12E+00
Endometriosis GA10 Endometrium tissue 2.66E-01 3.00E-02 1.41E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.31E-01 -9.36E-02 -6.12E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.05E-07 -5.30E-01 -1.85E+00
Gastric cancer 2B72 Gastric tissue 2.10E-01 -8.70E-02 -6.22E-01
Glioblastopma 2A00.00 Nervous tissue 1.23E-02 5.87E-04 2.43E-03
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.99E-06 -5.64E-01 -3.19E+00
Head and neck cancer 2D42 Head and neck tissue 2.89E-01 -4.76E-03 -2.34E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.64E-02 -9.09E-02 -7.63E-01
Huntington's disease 8A01.10 Whole blood 4.58E-01 -3.76E-02 -2.39E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.55E-01 8.28E-02 4.46E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.94E-01 -2.13E-02 -2.72E-01
Influenza 1.00E+30 Whole blood 1.83E-02 4.83E-01 3.10E+00
Interstitial cystitis GC00.3 Bladder tissue 1.84E-01 2.97E-02 4.90E-01
Intracranial aneurysm 8B01.0 Intracranial artery 7.31E-01 9.60E-02 4.53E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.58E-01 -1.43E-02 -9.42E-02
Ischemic stroke 8B11 Peripheral blood 8.49E-02 9.92E-02 6.06E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.10E-01 2.00E-02 7.88E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 5.70E-01 1.75E-02 1.15E-01
Lateral sclerosis 8B60.4 Skin 4.36E-01 9.83E-02 6.51E-01
Liver cancer 2C12.0 Liver tissue 2.76E-09 -2.02E-01 -9.76E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.26E-01 -9.27E-03 -8.59E-02
Lung cancer 2C25 Lung tissue 8.45E-01 9.43E-04 4.56E-03
Lupus erythematosus 4A40 Whole blood 7.33E-02 -2.33E-01 -2.75E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.55E-01 5.04E-03 2.47E-02
Major depressive disorder 6A70-6A7Z Hippocampus 3.53E-01 2.13E-02 1.80E-01
Melanoma 2C30 Skin 4.50E-01 1.88E-01 2.36E-01
Multiple myeloma 2A83.1 Bone marrow 3.69E-01 -1.13E-01 -8.69E-01
Multiple myeloma 2A83.1 Peripheral blood 5.89E-01 5.63E-03 3.22E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.33E-01 1.36E-03 5.06E-03
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.12E-01 1.35E-02 7.54E-02
Myelofibrosis 2A20.2 Whole blood 6.47E-01 -2.59E-02 -1.97E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.40E-01 2.57E-01 2.68E-01
Myopathy 8C70.6 Muscle tissue 1.32E-02 -1.26E-01 -1.56E+00
Neonatal sepsis KA60 Whole blood 8.43E-04 -1.17E-01 -4.10E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.75E-04 -6.00E-01 -1.78E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.46E-01 1.31E-02 8.52E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.54E-01 -2.70E-02 -1.86E-01
Olive pollen allergy CA08.00 Peripheral blood 2.27E-01 1.48E-01 7.41E-01
Oral cancer 2B6E Oral tissue 5.29E-04 -3.28E-01 -1.18E+00
Osteoarthritis FA00-FA0Z Synovial tissue 8.10E-01 -1.96E-02 -2.02E-01
Osteoporosis FB83.1 Bone marrow 1.42E-02 3.58E-01 3.35E+00
Ovarian cancer 2C73 Ovarian tissue 1.68E-02 -2.20E-01 -1.10E+00
Pancreatic cancer 2C10 Pancreas 1.34E-03 -5.89E-01 -1.26E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 8.89E-01 5.11E-02 3.13E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.09E-01 -3.17E-02 -3.38E-01
Pituitary cancer 2D12 Pituitary tissue 5.99E-01 2.62E-02 7.01E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.91E-01 -1.57E-02 -7.57E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.66E-02 1.25E-01 1.40E+00
Polycythemia vera 2A20.4 Whole blood 3.90E-03 -3.92E-02 -3.12E-01
Pompe disease 5C51.3 Biceps muscle 3.33E-02 -4.88E-02 -4.33E-01
Preterm birth KA21.4Z Myometrium 2.13E-02 -1.22E-01 -1.12E+00
Prostate cancer 2C82 Prostate 1.88E-04 -1.35E+00 -1.49E+00
Psoriasis EA90 Skin 5.99E-13 -1.88E-01 -4.68E-01
Rectal cancer 2B92 Rectal colon tissue 3.42E-01 1.51E-02 8.37E-02
Renal cancer 2C90-2C91 Kidney 1.60E-03 -5.57E-01 -1.33E+00
Retinoblastoma 2D02.2 Uvea 6.81E-02 -1.12E-01 -1.18E+00
Rheumatoid arthritis FA20 Synovial tissue 2.72E-02 -1.31E-01 -7.81E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.93E-01 -3.11E-03 -3.21E-02
Schizophrenia 6A20 Prefrontal cortex 7.57E-01 -1.32E-02 -6.21E-02
Schizophrenia 6A20 Superior temporal cortex 5.71E-01 -2.35E-02 -3.38E-01
Scleroderma 4A42.Z Whole blood 5.40E-03 9.81E-02 1.13E+00
Seizure 8A60-8A6Z Whole blood 1.81E-01 -4.49E-02 -3.18E-01
Sensitive skin EK0Z Skin 2.56E-01 1.25E-01 7.77E-01
Sepsis with septic shock 1G41 Whole blood 3.16E-02 -1.10E-02 -4.56E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.68E-02 5.60E-01 1.20E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.78E-01 4.09E-02 2.17E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.68E-01 1.80E-01 2.05E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.74E-01 -2.23E-01 -9.00E-01
Skin cancer 2C30-2C3Z Skin 1.37E-09 -1.85E-01 -3.22E-01
Thrombocythemia 3B63 Whole blood 1.64E-01 -5.54E-02 -3.98E-01
Thrombocytopenia 3B64 Whole blood 8.11E-01 9.63E-02 4.56E-01
Thyroid cancer 2D10 Thyroid 4.86E-02 3.97E-02 1.58E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.73E-01 -9.68E-02 -5.76E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.43E-03 1.95E-01 3.99E+00
Type 2 diabetes 5A11 Liver tissue 1.84E-01 -1.85E-01 -8.57E-01
Ureter cancer 2C92 Urothelium 9.28E-01 4.85E-03 3.64E-02
Uterine cancer 2C78 Endometrium tissue 8.34E-04 -9.23E-02 -4.05E-01
Vitiligo ED63.0 Skin 4.09E-02 -1.57E-01 -1.25E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Phosphate transporters and their function. Annu Rev Physiol. 2013;75:535-50.