Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTKXTPW)

DTP Name Sodium/dicarboxylate cotransporter 3 (SLC13A3)
Gene Name SLC13A3
UniProt ID
Q8WWT9 (S13A3_HUMAN)
VARIDT ID
DTD0093
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ARLIAK; NADC3; Na(+)/dicarboxylate cotransporter 3; NaDC-3; SDCT2; SLC13A3; Solute carrier family 13 member 3; hNaDC3; Sodium-dependent high-affinity dicarboxylate transporter 2
DTP Family Divalent Anion:Na(+) Symporter (DASS) Family ;
Tissue Specificity Expression is highest in kidney. Detected inplacenta, brain, liver and pancreas.
Sequence
MAALAAAAKKVWSARRLLVLLFTPLALLPVVFALPPKEGRCLFVILLMAVYWCTEALPLS
VTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGLIMASAIEEWNLHRRIALKILMLV
GVQPARLILGMMVTTSFLSMWLSNTASTAMMLPIANAILKSLFGQKEVRKDPSQESEENT
AAVRRNGLHTVPTEMQFLASTEAKDHPGETEVPLDLPADSRKEDEYRRNIWKGFLISIPY
SASIGGTATLTGTAPNLILLGQLKSFFPQCDVVNFGSWFIFAFPLMLLFLLAGWLWISFL
YGGLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMFAILLFTRD
PKFIPGWASLFNPGFLSDAVTGVAIVTILFFFPSQRPSLKWWFDFKAPNTETEPLLTWKK
AQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVPPALAVLLITVVIAFFTE
FASNTATIIIFLPVLAELAIRLRVHPLYLMIPGTVGCSFAFMLPVSTPPNSIAFASGHLL
VKDMVRTGLLMNLMGVLLLSLAMNTWAQTIFQLGTFPDWADMYSVNVTALPPTLANDTFR
TL
Function This sodium-dicarboxylate cotransporter can mediates the transport of succinate and other Krebs cycle intermediates.
Endogenous Substrate(s) Dicarboxylates; Na+
TCDB ID
2.A.47.1.15
Gene ID
64849
Reactome Pathway
Sodium-coupled sulphate, di- and tri-carboxylate transporters (R-HSA-433137 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
3 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
alpha-ketoglutaric acid DM5LFYN Discovery agent N.A. Investigative [1]
Dicarboxylate DML3HEM N. A. N. A. Investigative [1]
Succinate DMPY09A N. A. N. A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.75E-02 1.05E-02 5.37E-02
Adrenocortical carcinoma 2D11.Z Kidney 1.51E-01 1.63E-02 7.14E-02
Alopecia ED70 Skin from scalp 1.47E-01 -6.01E-02 -3.80E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.60E-01 4.14E-02 1.37E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.49E-01 -8.08E-02 -8.80E-01
Aortic stenosis BB70 Calcified aortic valve 8.11E-01 2.97E-03 6.27E-03
Apnea 7A40 Hyperplastic tonsil 5.15E-01 -2.34E-02 -7.34E-02
Arthropathy FA00-FA5Z Peripheral blood 7.40E-01 4.47E-02 3.78E-01
Asthma CA23 Nasal and bronchial airway 3.06E-02 -1.12E-01 -2.06E-01
Atopic dermatitis EA80 Skin 9.31E-02 3.26E-02 3.49E-01
Autism 6A02 Whole blood 1.78E-02 -1.22E-01 -7.05E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.02E-02 -3.08E-01 -2.21E+00
Autosomal dominant monocytopenia 4B04 Whole blood 6.00E-01 3.21E-02 2.71E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.38E-01 -5.48E-02 -2.51E-01
Batten disease 5C56.1 Whole blood 5.79E-01 -5.57E-03 -6.56E-02
Behcet's disease 4A62 Peripheral blood 8.94E-03 1.63E-01 1.32E+00
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.59E-02 1.41E-01 1.01E+00
Bladder cancer 2C94 Bladder tissue 1.68E-05 7.98E-01 3.95E+00
Breast cancer 2C60-2C6Z Breast tissue 8.46E-02 2.44E-02 6.70E-02
Cardioembolic stroke 8B11.20 Whole blood 5.09E-02 5.89E-02 4.06E-01
Cervical cancer 2C77 Cervical tissue 9.15E-01 3.55E-02 1.50E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.06E-01 -1.30E-02 -6.65E-02
Chronic hepatitis C 1E51.1 Whole blood 2.31E-01 7.58E-02 6.71E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.40E-01 4.08E-02 3.03E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.67E-02 -1.48E-01 -2.40E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.99E-03 -2.50E-01 -1.22E+00
Colon cancer 2B90 Colon tissue 2.90E-51 2.89E-01 1.32E+00
Coronary artery disease BA80-BA8Z Peripheral blood 6.33E-01 -6.89E-02 -5.91E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.50E-01 -7.83E-02 -5.11E-01
Endometriosis GA10 Endometrium tissue 5.02E-02 1.37E-01 5.93E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.72E-01 -2.67E-02 -2.46E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.75E-02 -1.61E-01 -7.64E-01
Gastric cancer 2B72 Gastric tissue 3.17E-02 -2.95E-01 -3.77E+00
Glioblastopma 2A00.00 Nervous tissue 1.52E-24 -2.10E-01 -6.41E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.26E-03 -4.81E-01 -1.24E+00
Head and neck cancer 2D42 Head and neck tissue 4.16E-11 -1.82E-01 -2.18E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.19E-01 -6.21E-02 -3.24E-01
Huntington's disease 8A01.10 Whole blood 1.14E-01 6.89E-02 8.48E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.83E-01 2.04E-02 1.12E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.65E-01 1.44E-01 1.08E+00
Influenza 1.00E+30 Whole blood 1.90E-02 2.38E-01 2.60E+00
Interstitial cystitis GC00.3 Bladder tissue 6.85E-02 -6.35E-02 -6.86E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.94E-01 6.18E-02 5.21E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.35E-01 4.94E-02 1.63E-01
Ischemic stroke 8B11 Peripheral blood 7.32E-01 1.05E-02 1.32E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.08E-02 1.05E-01 6.16E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.91E-01 1.25E-01 8.82E-01
Lateral sclerosis 8B60.4 Skin 8.03E-01 -4.79E-02 -3.03E-01
Liver cancer 2C12.0 Liver tissue 7.65E-03 7.12E-03 1.93E-02
Liver failure DB99.7-DB99.8 Liver tissue 1.25E-03 -7.91E-01 -2.03E+00
Lung cancer 2C25 Lung tissue 6.48E-24 1.61E-01 8.58E-01
Lupus erythematosus 4A40 Whole blood 2.65E-01 -1.58E-01 -3.60E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.50E-01 3.09E-02 1.50E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.52E-01 7.67E-02 5.65E-01
Melanoma 2C30 Skin 3.86E-03 7.39E-01 1.24E+00
Multiple myeloma 2A83.1 Bone marrow 4.80E-05 -4.28E-01 -3.10E+00
Multiple myeloma 2A83.1 Peripheral blood 2.85E-01 4.94E-02 3.49E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.49E-01 -1.37E-01 -6.04E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.57E-01 -1.02E-01 -3.83E-01
Myelofibrosis 2A20.2 Whole blood 7.14E-02 1.04E-01 7.77E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.45E-02 1.76E-01 4.89E-01
Myopathy 8C70.6 Muscle tissue 5.32E-01 -2.42E-02 -2.01E-01
Neonatal sepsis KA60 Whole blood 1.40E-03 -1.34E-01 -5.76E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.37E-07 -9.46E-01 -3.71E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 8.75E-02 -5.06E-02 -3.78E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.95E-01 1.04E-01 8.25E-01
Olive pollen allergy CA08.00 Peripheral blood 8.64E-02 2.51E-01 1.28E+00
Oral cancer 2B6E Oral tissue 9.29E-04 -2.34E-01 -6.97E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.99E-01 -2.07E-01 -1.14E+00
Osteoporosis FB83.1 Bone marrow 8.98E-01 -4.82E-03 -2.97E-02
Ovarian cancer 2C73 Ovarian tissue 2.23E-01 -8.24E-02 -3.97E-01
Pancreatic cancer 2C10 Pancreas 1.16E-01 -1.13E-01 -3.25E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.05E-01 1.10E-02 4.55E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.61E-02 -3.25E-02 -3.75E-01
Pituitary cancer 2D12 Pituitary tissue 7.77E-01 -4.80E-02 -2.11E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.66E-01 -8.78E-02 -3.59E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.37E-02 1.02E-01 1.19E+00
Polycythemia vera 2A20.4 Whole blood 3.46E-09 1.77E-01 1.66E+00
Pompe disease 5C51.3 Biceps muscle 5.47E-01 5.31E-03 8.09E-02
Preterm birth KA21.4Z Myometrium 4.53E-01 4.67E-02 4.49E-01
Prostate cancer 2C82 Prostate 2.39E-01 1.74E-01 2.94E-01
Psoriasis EA90 Skin 1.24E-02 -5.60E-02 -2.11E-01
Rectal cancer 2B92 Rectal colon tissue 4.18E-04 2.24E-01 1.81E+00
Renal cancer 2C90-2C91 Kidney 1.02E-02 -9.78E-01 -9.18E-01
Retinoblastoma 2D02.2 Uvea 3.47E-01 2.60E-03 2.54E-02
Rheumatoid arthritis FA20 Synovial tissue 5.53E-02 -5.96E-02 -3.98E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.19E-01 -1.42E-01 -3.93E-01
Schizophrenia 6A20 Prefrontal cortex 3.61E-01 -3.71E-02 -1.43E-01
Schizophrenia 6A20 Superior temporal cortex 6.99E-02 -2.87E-02 -2.45E-01
Scleroderma 4A42.Z Whole blood 3.09E-01 6.42E-02 8.14E-01
Seizure 8A60-8A6Z Whole blood 2.01E-01 4.60E-02 3.96E-01
Sensitive skin EK0Z Skin 8.02E-01 -5.02E-02 -4.36E-01
Sepsis with septic shock 1G41 Whole blood 8.67E-02 -3.85E-02 -1.72E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.23E-02 6.96E-01 1.51E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.24E-01 1.06E-01 7.71E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.63E-01 -1.30E-02 -5.61E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.93E-01 -2.10E-01 -1.29E+00
Skin cancer 2C30-2C3Z Skin 2.23E-16 2.67E-01 8.85E-01
Thrombocythemia 3B63 Whole blood 7.36E-03 6.69E-02 5.25E-01
Thrombocytopenia 3B64 Whole blood 4.87E-01 -6.70E-02 -3.67E-01
Thyroid cancer 2D10 Thyroid 3.17E-08 9.94E-02 5.64E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.27E-02 -1.06E-01 -6.49E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.51E-01 2.07E-01 1.22E+00
Type 2 diabetes 5A11 Liver tissue 5.92E-01 7.04E-02 3.33E-01
Ureter cancer 2C92 Urothelium 5.55E-01 -2.21E-02 -1.73E-01
Uterine cancer 2C78 Endometrium tissue 1.82E-03 -9.71E-02 -4.10E-01
Vitiligo ED63.0 Skin 1.88E-01 -3.97E-02 -2.99E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

Drug Affinity of This DTP Assessed by Cell Line

Investigative Drug(s)
Drug Name Highest Status Cell Line Affinity REF
alpha-ketoglutaric acid Investigative HEK293T cells-NADC3 Km = 149.0 microM [1]

References

1 SLC13A3 variants cause acute reversible leukoencephalopathy and -ketoglutarate accumulation. Ann Neurol. 2019 Mar;85(3):385-395.