Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTL1TRY)

DTP Name Adenine nucleotide translocator 2 (SLC25A5)
Gene Name SLC25A5
UniProt ID
P05141 (ADT2_HUMAN)
VARIDT ID
DTD0213
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms
2F1; AAC2; ADP,ATP carrier protein 2; ADP,ATP carrier protein, fibroblast isoform; ANT 2; ANT2; ADP/ATP translocase 2, N-terminally processed; SLC25A5; Solute carrier family 25 member 5; T2; T3; ADP/ATP translocase 2; ADP/ATP translocase 2, N-terminally processed
DTP Family Mitochondrial Carrier (MC) Family ;
Sequence
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWLYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYT
Function This transporter catalyzes the exchange of cytoplasmic ADP with mitochondrial ATP across the mitochondrial inner membrane. It may play a role in chromosome segregation.
Endogenous Substrate(s) ATP; ADP
TCDB ID
2.A.29.1.1
Gene ID
292
KEGG Pathway
Calcium signaling pathway (hsa04020 )
cGMP-PKG signaling pathway (hsa04022 )
Necroptosis (hsa04217 )
Cellular senescence (hsa04218 )
Neutrophil extracellular trap formation (hsa04613 )
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )
Huntington disease (hsa05016 )
Spinocerebellar ataxia (hsa05017 )
Prion disease (hsa05020 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Influenza A (hsa05164 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Chemical carcinogenesis - reactive oxygen species (hsa05208 )
Diabetic cardiomyopathy (hsa05415 )
Reactome Pathway
Transport of nucleosides and free purine and pyrimidine bases across the plasma membrane (R-HSA-83936 )
Vpr-mediated induction of apoptosis by mitochondrial outer membrane permeabilization (R-HSA-180897 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.46E-18 2.62E-01 1.03E+00
Adrenocortical carcinoma 2D11.Z Kidney 1.18E-02 1.46E-01 8.79E-01
Alopecia ED70 Skin from scalp 7.21E-01 2.96E-03 1.56E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.82E-04 -2.45E-01 -7.22E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.86E-02 1.13E-01 7.28E-01
Aortic stenosis BB70 Calcified aortic valve 9.05E-01 -9.84E-02 -8.93E-02
Apnea 7A40 Hyperplastic tonsil 6.26E-01 6.64E-01 8.89E-01
Arthropathy FA00-FA5Z Peripheral blood 2.65E-02 -1.55E-01 -1.21E+00
Asthma CA23 Nasal and bronchial airway 1.84E-06 6.00E-01 8.52E-01
Atopic dermatitis EA80 Skin 1.91E-02 2.74E-01 1.84E+00
Autism 6A02 Whole blood 2.77E-02 -1.86E-01 -6.80E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.17E-03 -4.09E-01 -2.38E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.95E-01 1.97E-01 6.82E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.47E-14 -2.52E-01 -1.36E+00
Batten disease 5C56.1 Whole blood 5.11E-01 -7.04E-02 -4.67E-01
Behcet's disease 4A62 Peripheral blood 1.57E-01 3.92E-02 3.39E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.40E-01 -1.70E-02 -5.13E-02
Bladder cancer 2C94 Bladder tissue 3.53E-01 4.83E-02 7.08E-01
Breast cancer 2C60-2C6Z Breast tissue 8.22E-35 3.32E-01 9.47E-01
Cardioembolic stroke 8B11.20 Whole blood 3.02E-05 -1.37E-01 -1.14E+00
Cervical cancer 2C77 Cervical tissue 2.05E-01 1.09E-01 3.69E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.94E-01 -7.53E-02 -7.32E-02
Chronic hepatitis C 1E51.1 Whole blood 2.96E-01 9.99E-02 6.06E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.84E-01 -6.24E-02 -2.65E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.61E-04 -1.67E-01 -4.86E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.38E-01 -3.56E-01 -4.91E-01
Colon cancer 2B90 Colon tissue 8.79E-58 -3.71E-01 -1.70E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.56E-01 3.46E-01 8.99E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.45E-01 7.39E-02 2.94E-01
Endometriosis GA10 Endometrium tissue 2.70E-04 -5.47E-01 -1.57E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.08E-01 5.45E-02 2.43E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.43E-13 9.03E-01 1.73E+00
Gastric cancer 2B72 Gastric tissue 4.37E-01 -4.99E-01 -8.77E-01
Glioblastopma 2A00.00 Nervous tissue 2.78E-12 2.02E-01 4.73E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.27E-05 1.05E+00 2.09E+00
Head and neck cancer 2D42 Head and neck tissue 3.55E-02 9.03E-02 2.20E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.46E-01 -1.18E-01 -2.20E-01
Huntington's disease 8A01.10 Whole blood 2.45E-01 -4.56E-01 -1.20E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.88E-03 -4.08E-01 -2.22E+00
Immunodeficiency 4A00-4A20 Peripheral blood 8.00E-04 2.72E-01 2.01E+00
Influenza 1.00E+30 Whole blood 2.43E-04 -7.91E-01 -6.02E+00
Interstitial cystitis GC00.3 Bladder tissue 5.46E-01 -8.09E-02 -5.59E-01
Intracranial aneurysm 8B01.0 Intracranial artery 7.57E-02 1.50E-01 6.62E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.79E-02 -3.75E-01 -1.10E+00
Ischemic stroke 8B11 Peripheral blood 2.98E-01 -2.47E-02 -1.63E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.21E-10 -7.53E-01 -1.52E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 4.45E-01 4.02E-03 3.44E-03
Lateral sclerosis 8B60.4 Skin 4.65E-02 2.35E-01 1.68E+00
Liver cancer 2C12.0 Liver tissue 2.89E-01 1.74E-02 5.51E-02
Liver failure DB99.7-DB99.8 Liver tissue 4.29E-01 1.80E-01 5.98E-01
Lung cancer 2C25 Lung tissue 1.20E-28 3.01E-01 1.15E+00
Lupus erythematosus 4A40 Whole blood 5.18E-01 1.40E-01 2.80E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.70E-01 -2.06E-02 -4.90E-02
Major depressive disorder 6A70-6A7Z Hippocampus 5.30E-01 -7.77E-02 -2.49E-01
Melanoma 2C30 Skin 5.37E-01 9.90E-02 3.17E-01
Multiple myeloma 2A83.1 Bone marrow 4.43E-06 1.81E+00 4.59E+00
Multiple myeloma 2A83.1 Peripheral blood 5.33E-01 -1.60E-01 -3.11E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.03E-01 -8.56E-02 -3.82E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.52E-05 -9.45E-02 -5.08E-01
Myelofibrosis 2A20.2 Whole blood 3.88E-05 -3.75E-01 -1.75E+00
Myocardial infarction BA41-BA50 Peripheral blood 6.12E-01 -1.54E-01 -3.59E-01
Myopathy 8C70.6 Muscle tissue 5.38E-04 7.54E-01 1.88E+00
Neonatal sepsis KA60 Whole blood 9.62E-10 -4.29E-01 -1.15E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.86E-02 4.42E-01 1.51E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.04E-01 5.75E-02 1.28E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.01E-01 -3.74E-01 -6.68E-01
Olive pollen allergy CA08.00 Peripheral blood 3.06E-01 2.34E-01 2.91E-01
Oral cancer 2B6E Oral tissue 7.56E-03 2.69E-01 5.33E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.60E-01 2.89E-01 2.64E-01
Osteoporosis FB83.1 Bone marrow 3.83E-01 -1.24E-01 -3.35E-01
Ovarian cancer 2C73 Ovarian tissue 1.29E-03 9.69E-01 1.89E+00
Pancreatic cancer 2C10 Pancreas 1.94E-01 -8.12E-02 -1.85E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.65E-01 -2.03E-01 -4.02E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.80E-03 -1.22E-01 -8.64E-01
Pituitary cancer 2D12 Pituitary tissue 7.56E-02 1.30E-01 4.85E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.79E-01 -2.21E-01 -8.03E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.70E-01 8.76E-02 3.74E-01
Polycythemia vera 2A20.4 Whole blood 2.68E-20 -5.14E-01 -2.45E+00
Pompe disease 5C51.3 Biceps muscle 3.31E-04 8.16E-01 2.35E+00
Preterm birth KA21.4Z Myometrium 3.36E-01 -2.26E-01 -1.17E+00
Prostate cancer 2C82 Prostate 1.19E-01 1.46E-01 5.47E-01
Psoriasis EA90 Skin 8.51E-28 3.76E-01 1.98E+00
Rectal cancer 2B92 Rectal colon tissue 5.41E-06 -3.18E-01 -3.15E+00
Renal cancer 2C90-2C91 Kidney 2.32E-06 -1.14E+00 -2.80E+00
Retinoblastoma 2D02.2 Uvea 1.72E-01 2.06E-01 7.14E-01
Rheumatoid arthritis FA20 Synovial tissue 3.09E-04 1.10E+00 2.39E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.72E-01 6.59E-03 4.70E-02
Schizophrenia 6A20 Prefrontal cortex 2.84E-01 -3.29E-02 -8.02E-02
Schizophrenia 6A20 Superior temporal cortex 8.88E-02 -1.95E-01 -5.91E-01
Scleroderma 4A42.Z Whole blood 3.49E-04 -2.31E-01 -1.73E+00
Seizure 8A60-8A6Z Whole blood 8.15E-01 2.97E-01 5.07E-01
Sensitive skin EK0Z Skin 1.69E-02 8.21E-02 1.88E+00
Sepsis with septic shock 1G41 Whole blood 4.62E-36 -5.63E-01 -1.62E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.67E-04 -4.19E-01 -4.52E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.72E-02 -5.90E-01 -1.20E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 8.42E-01 -3.68E-02 -9.76E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.18E-01 3.54E-02 2.19E-01
Skin cancer 2C30-2C3Z Skin 2.84E-01 7.53E-02 3.23E-01
Thrombocythemia 3B63 Whole blood 6.07E-11 -5.09E-01 -2.33E+00
Thrombocytopenia 3B64 Whole blood 6.64E-01 7.54E-02 1.42E-01
Thyroid cancer 2D10 Thyroid 2.12E-01 8.58E-02 2.69E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.59E-09 8.55E-01 3.65E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.69E-02 -3.64E-01 -3.19E+00
Type 2 diabetes 5A11 Liver tissue 4.74E-01 -1.02E-01 -7.83E-01
Ureter cancer 2C92 Urothelium 7.30E-01 5.02E-02 8.90E-02
Uterine cancer 2C78 Endometrium tissue 5.75E-01 3.20E-01 5.36E-01
Vitiligo ED63.0 Skin 8.95E-01 -4.07E-03 -3.30E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases