Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTLA4Q2)

DTP Name Thiamine transporter 1 (SLC19A2)
Gene Name SLC19A2
UniProt ID
O60779 (S19A2_HUMAN)
VARIDT ID
DTD0127
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC19A2; Solute carrier family 19 member 2; TC1; THMD1; THT1; TRMA; ThTr-1; ThTr1; Thiamine carrier 1
DTP Family Reduced Folate Carrier (RFC) Family ;
Tissue Specificity Ubiquitous; most abundant in skeletal andcardiac muscle. Medium expression in placenta, heart, liver andkidney, low in lung.
Sequence
MDVPGPVSRRAAAAAATVLLRTARVRRECWFLPTALLCAYGFFASLRPSEPFLTPYLLGP
DKNLTEREVFNEIYPVWTYSYLVLLFPVFLATDYLRYKPVVLLQGLSLIVTWFMLLYAQG
LLAIQFLEFFYGIATATEIAYYSYIYSVVDLGMYQKVTSYCRSATLVGFTVGSVLGQILV
SVAGWSLFSLNVISLTCVSVAFAVAWFLPMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTD
TPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWNDFLMCYSSRPLLCWSV
WWALSTCGYFQVVNYTQGLWEKVMPSRYAAIYNGGVEAVSTLLGAVAVFAVGYIKISWST
WGEMTLSLFSLLIAAAVYIMDTVGNIWVCYASYVVFRIIYMLLITIATFQIAANLSMERY
ALVFGVNTFIALALQTLLTLIVVDASGLGLEITTQFLIYASYFALIAVVFLASGAVSVMK
KCRKLEDPQSSSQVTTS
Function This transporter is high-affinity transporter for the intake of thiamine.
Endogenous Substrate(s) Thiamine
TCDB ID
2.A.48.1.2
Gene ID
10560
KEGG Pathway
Vitamin digestion and absorption (hsa04977 )
Reactome Pathway
Vitamin B1 (thiamin) metabolism (R-HSA-196819 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Metformin DM89QE1 Colorectal carcinoma Approved [2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.88E-07 -5.73E-01 -6.16E-01
Adrenocortical carcinoma 2D11.Z Kidney 2.22E-01 -6.76E-01 -5.85E-01
Alopecia ED70 Skin from scalp 9.83E-01 5.38E-02 1.56E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.66E-01 1.73E-02 3.82E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 2.81E-01 1.28E-02 2.84E-02
Aortic stenosis BB70 Calcified aortic valve 1.98E-01 -1.17E+00 -6.90E-01
Apnea 7A40 Hyperplastic tonsil 3.90E-02 -1.28E+00 -1.16E+00
Arthropathy FA00-FA5Z Peripheral blood 5.78E-01 -1.01E-01 -2.41E-01
Asthma CA23 Nasal and bronchial airway 4.42E-01 1.28E-01 2.30E-01
Atopic dermatitis EA80 Skin 1.37E-02 -1.83E-01 -5.53E-01
Autism 6A02 Whole blood 1.56E-02 4.14E-01 7.59E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.54E-01 4.91E-01 7.22E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.94E-01 1.45E+00 1.02E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.31E-26 -1.16E+00 -2.19E+00
Batten disease 5C56.1 Whole blood 3.22E-01 6.41E-02 5.13E-01
Behcet's disease 4A62 Peripheral blood 4.42E-01 -2.62E-01 -4.22E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.50E-02 1.04E-01 4.14E-01
Bladder cancer 2C94 Bladder tissue 1.31E-01 -3.39E-01 -6.75E-01
Breast cancer 2C60-2C6Z Breast tissue 1.05E-37 7.73E-01 9.48E-01
Cardioembolic stroke 8B11.20 Whole blood 5.43E-01 -7.83E-02 -2.03E-01
Cervical cancer 2C77 Cervical tissue 1.91E-02 -3.87E-01 -5.46E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.91E-01 -1.91E-01 -4.03E-01
Chronic hepatitis C 1E51.1 Whole blood 5.89E-01 1.96E-02 5.37E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 3.15E-02 7.28E-01 7.93E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.36E-02 -2.70E-01 -4.57E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.08E-03 -2.12E+00 -1.77E+00
Colon cancer 2B90 Colon tissue 7.41E-71 1.09E+00 2.19E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.97E-02 4.92E-01 1.17E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.82E-01 1.36E-01 1.56E-01
Endometriosis GA10 Endometrium tissue 4.31E-03 3.72E-01 8.11E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.80E-01 -9.97E-03 -2.23E-02
Familial hypercholesterolemia 5C80.00 Whole blood 1.15E-03 6.19E-01 1.47E+00
Gastric cancer 2B72 Gastric tissue 7.38E-01 -6.20E-01 -5.79E-01
Glioblastopma 2A00.00 Nervous tissue 2.52E-69 1.33E+00 1.39E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.39E-01 1.85E-01 4.47E-01
Head and neck cancer 2D42 Head and neck tissue 8.62E-01 -3.96E-02 -5.97E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.61E-01 -8.11E-02 -1.76E-01
Huntington's disease 8A01.10 Whole blood 7.44E-01 -3.43E-03 -1.36E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.51E-04 -2.08E+00 -3.45E+00
Immunodeficiency 4A00-4A20 Peripheral blood 7.97E-02 -1.35E-01 -8.74E-01
Influenza 1.00E+30 Whole blood 8.26E-05 -1.89E+00 -1.01E+01
Interstitial cystitis GC00.3 Bladder tissue 8.06E-06 -1.47E+00 -5.60E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.35E-01 -9.31E-01 -5.43E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.47E-02 7.21E-02 3.16E-01
Ischemic stroke 8B11 Peripheral blood 4.25E-01 -1.36E-01 -4.40E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.22E-01 -1.49E-02 -2.61E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 6.79E-01 9.68E-02 1.60E-01
Lateral sclerosis 8B60.4 Skin 6.96E-02 -4.53E-01 -9.83E-01
Liver cancer 2C12.0 Liver tissue 2.30E-01 -1.86E-01 -2.48E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.09E-04 -1.15E+00 -1.55E+00
Lung cancer 2C25 Lung tissue 2.29E-04 -2.34E-01 -2.51E-01
Lupus erythematosus 4A40 Whole blood 4.28E-02 4.91E-01 4.77E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.97E-01 -6.03E-02 -8.76E-02
Major depressive disorder 6A70-6A7Z Hippocampus 1.54E-01 4.97E-02 1.97E-01
Melanoma 2C30 Skin 5.27E-01 6.37E-02 5.21E-02
Multiple myeloma 2A83.1 Bone marrow 1.12E-05 8.99E-01 3.03E+00
Multiple myeloma 2A83.1 Peripheral blood 1.40E-01 -9.33E-02 -2.29E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.27E-01 6.76E-02 2.31E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.05E-01 2.77E-01 6.35E-01
Myelofibrosis 2A20.2 Whole blood 3.46E-02 -3.05E-01 -6.24E-01
Myocardial infarction BA41-BA50 Peripheral blood 6.35E-01 1.83E-01 1.64E-01
Myopathy 8C70.6 Muscle tissue 2.23E-03 -6.14E-01 -1.57E+00
Neonatal sepsis KA60 Whole blood 8.05E-01 -3.49E-02 -5.31E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.58E-07 3.02E+00 4.03E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.67E-01 -8.02E-02 -1.15E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.25E-01 2.81E-01 6.19E-01
Olive pollen allergy CA08.00 Peripheral blood 1.13E-01 -1.15E+00 -1.43E+00
Oral cancer 2B6E Oral tissue 3.19E-01 9.68E-02 7.65E-02
Osteoarthritis FA00-FA0Z Synovial tissue 2.58E-01 -1.04E+00 -6.80E-01
Osteoporosis FB83.1 Bone marrow 8.29E-01 2.81E-01 5.53E-01
Ovarian cancer 2C73 Ovarian tissue 1.55E-01 -4.15E-01 -3.94E-01
Pancreatic cancer 2C10 Pancreas 1.15E-02 -5.99E-01 -5.28E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.43E-01 -1.48E-01 -2.06E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.90E-01 1.44E-01 4.06E-01
Pituitary cancer 2D12 Pituitary tissue 2.61E-04 -1.22E+00 -2.05E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.26E-03 -1.59E+00 -2.41E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.92E-01 -1.86E-03 -3.57E-03
Polycythemia vera 2A20.4 Whole blood 2.68E-01 -1.06E-01 -2.04E-01
Pompe disease 5C51.3 Biceps muscle 1.96E-01 -3.58E-01 -6.43E-01
Preterm birth KA21.4Z Myometrium 7.34E-01 -5.15E-01 -7.32E-01
Prostate cancer 2C82 Prostate 6.80E-04 1.02E+00 8.37E-01
Psoriasis EA90 Skin 9.00E-10 3.56E-01 6.79E-01
Rectal cancer 2B92 Rectal colon tissue 2.04E-01 1.68E-01 3.79E-01
Renal cancer 2C90-2C91 Kidney 4.70E-03 -6.33E-01 -1.36E+00
Retinoblastoma 2D02.2 Uvea 2.09E-10 1.68E+00 4.50E+00
Rheumatoid arthritis FA20 Synovial tissue 1.53E-02 -1.49E+00 -1.37E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.11E-01 -6.05E-02 -1.63E-01
Schizophrenia 6A20 Prefrontal cortex 2.50E-01 -3.37E-01 -5.79E-01
Schizophrenia 6A20 Superior temporal cortex 2.95E-01 -5.01E-02 -1.94E-01
Scleroderma 4A42.Z Whole blood 9.69E-01 7.36E-02 2.40E-01
Seizure 8A60-8A6Z Whole blood 3.62E-01 6.60E-01 1.01E+00
Sensitive skin EK0Z Skin 4.13E-01 -2.03E-02 -1.18E-01
Sepsis with septic shock 1G41 Whole blood 8.78E-08 -3.32E-01 -5.41E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.30E-01 -5.23E-01 -8.49E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.25E-01 -1.86E-01 -7.91E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.40E-01 -1.09E-02 -1.42E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.33E-01 3.27E-01 1.16E+00
Skin cancer 2C30-2C3Z Skin 4.92E-12 7.34E-01 1.21E+00
Thrombocythemia 3B63 Whole blood 5.54E-02 -2.02E-01 -4.21E-01
Thrombocytopenia 3B64 Whole blood 5.84E-01 9.88E-02 1.01E-01
Thyroid cancer 2D10 Thyroid 3.60E-16 -6.48E-01 -9.93E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.67E-04 -1.24E+00 -2.17E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.66E-01 1.53E-01 4.34E-01
Type 2 diabetes 5A11 Liver tissue 3.30E-01 8.46E-02 1.53E-01
Ureter cancer 2C92 Urothelium 7.47E-01 -2.06E-01 -3.86E-01
Uterine cancer 2C78 Endometrium tissue 3.95E-15 1.02E+00 1.16E+00
Vitiligo ED63.0 Skin 2.83E-01 -3.96E-02 -1.91E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Solute carrier family 19 member 2 (SLC19A2) DTT Info
DTP DTT Type Literature-reported
1 Investigative Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
[3H]thiamine DMSHW2E Hyperemesis gravidarum Investigative [1]
------------------------------------------------------------------------------------

References

1 Cloning of the human thiamine transporter, a member of the folate transporter family. J Biol Chem. 1999 Nov 5;274(45):31925-9.
2 Metformin Is a Substrate and Inhibitor of the Human Thiamine Transporter, THTR-2 (SLC19A3). Mol Pharm. 2015 Dec 7;12(12):4301-10.