Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTLBGTZ)

DTP Name Mitochondrial iron transporter 1 (SLC25A37)
Gene Name SLC25A37
UniProt ID
Q9NYZ2 (MFRN1_HUMAN)
VARIDT ID
DTD0199
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms HT015; MFRN; MFRN1; MSC; MSCP; Mitochondrial solute carrier protein; Mitoferrin-1; PRO1278; PRO1584; PRO2217; SLC25A37; Solute carrier family 25 member 37
DTP Family Mitochondrial Carrier (MC) Family ;
Sequence
MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSASVSTHMTAGAMAGILEH
SVMYPVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLRGVNVMIMGAGPAHAM
YFACYENMKRTLNDVFHHQGNSHLANGIAGSMATLLHDAVMNPAEVVKQRLQMYNSQHRS
AISCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPHRTYNPQSHIIS
GGLAGALAAAATTPLDVCKTLLNTQENVALSLANISGRLSGMANAFRTVYQLNGLAGYFK
GIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRAPY
Function This transporter mediates transport on mitochondrial inner membrane.
Endogenous Substrate(s) Iron
TCDB ID
2.A.29.5.7
Gene ID
51312
Reactome Pathway
Mitochondrial iron-sulfur cluster biogenesis (R-HSA-1362409 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.21E-13 -1.37E+00 -1.16E+00
Adrenocortical carcinoma 2D11.Z Kidney 3.48E-01 3.25E-01 8.41E-01
Alopecia ED70 Skin from scalp 6.68E-07 -3.39E-01 -1.10E+00
Alzheimer's disease 8A20 Entorhinal cortex 4.66E-05 1.41E-01 4.68E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.72E-01 2.98E-02 1.67E-01
Aortic stenosis BB70 Calcified aortic valve 8.73E-01 1.72E-02 1.10E-01
Apnea 7A40 Hyperplastic tonsil 9.38E-01 -4.57E-03 -1.71E-02
Arthropathy FA00-FA5Z Peripheral blood 1.29E-01 2.36E-01 6.90E-01
Asthma CA23 Nasal and bronchial airway 1.01E-03 2.69E-01 4.27E-01
Atopic dermatitis EA80 Skin 2.79E-05 3.99E-01 1.86E+00
Autism 6A02 Whole blood 3.97E-01 -1.13E-01 -2.37E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.67E-01 -1.70E-01 -2.20E-01
Autosomal dominant monocytopenia 4B04 Whole blood 8.17E-01 3.17E-02 1.36E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.15E-05 1.56E-01 5.04E-01
Batten disease 5C56.1 Whole blood 2.39E-01 -9.28E-02 -5.87E-01
Behcet's disease 4A62 Peripheral blood 3.28E-01 -1.47E-01 -2.74E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.64E-03 -1.46E-01 -1.14E+00
Bladder cancer 2C94 Bladder tissue 2.51E-04 -3.60E-01 -2.24E+00
Breast cancer 2C60-2C6Z Breast tissue 6.08E-01 1.13E-02 1.70E-02
Cardioembolic stroke 8B11.20 Whole blood 4.56E-01 -8.48E-02 -3.00E-01
Cervical cancer 2C77 Cervical tissue 9.78E-03 5.40E-01 9.71E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.31E-01 8.69E-01 5.49E-01
Chronic hepatitis C 1E51.1 Whole blood 4.86E-01 -4.56E-02 -7.58E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 7.20E-02 1.35E-01 3.41E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.11E-02 -1.86E-01 -3.23E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.41E-01 1.11E-01 6.78E-01
Colon cancer 2B90 Colon tissue 3.77E-05 1.03E-01 2.55E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.01E-01 -6.81E-02 -3.04E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.65E-01 5.86E-02 2.37E-01
Endometriosis GA10 Endometrium tissue 2.10E-01 1.64E-01 5.19E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.83E-01 -4.36E-01 -9.36E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.33E-12 -2.77E+00 -2.16E+00
Gastric cancer 2B72 Gastric tissue 4.07E-01 -2.06E-01 -8.01E-01
Glioblastopma 2A00.00 Nervous tissue 4.73E-01 -8.04E-02 -2.10E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.43E-01 1.72E-01 1.42E-01
Head and neck cancer 2D42 Head and neck tissue 1.23E-02 1.36E-01 2.58E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.19E-01 -3.75E-02 -1.77E-01
Huntington's disease 8A01.10 Whole blood 2.74E-01 2.79E-01 4.50E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.95E-02 -7.75E-01 -1.15E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.22E-04 -3.60E-01 -3.12E+00
Influenza 1.00E+30 Whole blood 1.52E-01 -1.74E+00 -2.54E+00
Interstitial cystitis GC00.3 Bladder tissue 5.46E-01 6.35E-02 3.96E-01
Intracranial aneurysm 8B01.0 Intracranial artery 8.20E-01 2.50E-01 3.88E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.71E-02 2.52E-02 7.67E-02
Ischemic stroke 8B11 Peripheral blood 3.93E-01 -8.71E-02 -1.55E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.14E-01 1.16E-01 7.24E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 6.50E-01 1.95E-02 9.94E-02
Lateral sclerosis 8B60.4 Skin 2.68E-01 -3.89E-01 -8.89E-01
Liver cancer 2C12.0 Liver tissue 2.34E-16 -6.73E-01 -2.19E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.63E-03 -4.72E-01 -1.80E+00
Lung cancer 2C25 Lung tissue 9.48E-01 9.50E-02 1.63E-01
Lupus erythematosus 4A40 Whole blood 9.71E-01 6.36E-02 3.49E-02
Major depressive disorder 6A70-6A7Z Whole blood 1.08E-01 6.01E-02 1.91E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.70E-01 -5.39E-02 -4.66E-01
Melanoma 2C30 Skin 3.17E-01 -3.46E-01 -3.47E-01
Multiple myeloma 2A83.1 Bone marrow 7.07E-01 -3.89E-02 -2.41E-01
Multiple myeloma 2A83.1 Peripheral blood 2.32E-01 9.67E-02 6.27E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.46E-02 3.07E-01 1.38E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.52E-04 4.09E-01 6.68E-01
Myelofibrosis 2A20.2 Whole blood 1.16E-01 3.00E-01 1.05E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.52E-03 1.72E+00 1.02E+00
Myopathy 8C70.6 Muscle tissue 6.08E-02 -2.31E-01 -1.19E+00
Neonatal sepsis KA60 Whole blood 3.43E-01 3.70E-01 3.77E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.89E-02 -2.85E-01 -9.00E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 3.01E-01 2.72E-01 5.77E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.33E-01 -3.33E-01 -7.29E-01
Olive pollen allergy CA08.00 Peripheral blood 6.88E-01 8.79E-02 8.12E-02
Oral cancer 2B6E Oral tissue 6.12E-01 7.45E-02 1.30E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.95E-01 3.94E-01 6.46E-01
Osteoporosis FB83.1 Bone marrow 7.14E-01 -1.81E-01 -5.96E-01
Ovarian cancer 2C73 Ovarian tissue 2.38E-04 -7.64E-01 -1.79E+00
Pancreatic cancer 2C10 Pancreas 2.56E-01 6.09E-01 7.06E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.72E-01 3.74E-01 1.02E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.02E-05 1.24E+00 2.46E+00
Pituitary cancer 2D12 Pituitary tissue 4.04E-03 -6.94E-01 -1.22E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.64E-04 -8.59E-01 -1.73E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.48E-01 1.97E-01 8.32E-01
Polycythemia vera 2A20.4 Whole blood 4.18E-06 4.33E-01 1.36E+00
Pompe disease 5C51.3 Biceps muscle 8.22E-03 -4.26E-01 -1.48E+00
Preterm birth KA21.4Z Myometrium 4.35E-01 -1.40E-01 -2.34E-01
Prostate cancer 2C82 Prostate 6.62E-02 3.51E-01 5.08E-01
Psoriasis EA90 Skin 3.20E-06 2.61E-01 6.37E-01
Rectal cancer 2B92 Rectal colon tissue 5.39E-03 3.72E-01 1.35E+00
Renal cancer 2C90-2C91 Kidney 6.17E-01 1.28E-01 2.80E-01
Retinoblastoma 2D02.2 Uvea 1.34E-01 9.22E-02 4.88E-01
Rheumatoid arthritis FA20 Synovial tissue 1.51E-15 1.23E+00 8.38E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.50E-01 1.22E-01 3.42E-01
Schizophrenia 6A20 Prefrontal cortex 4.43E-03 2.84E-01 5.54E-01
Schizophrenia 6A20 Superior temporal cortex 5.59E-01 6.41E-02 3.17E-01
Scleroderma 4A42.Z Whole blood 8.98E-04 3.59E-01 1.95E+00
Seizure 8A60-8A6Z Whole blood 7.20E-01 1.59E-01 3.09E-01
Sensitive skin EK0Z Skin 7.53E-01 1.50E-01 5.24E-01
Sepsis with septic shock 1G41 Whole blood 1.03E-24 5.68E-01 1.07E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.51E-03 1.10E+00 1.87E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.31E-03 2.18E-01 1.51E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.82E-01 -2.13E-01 -1.01E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.63E-03 -4.82E-01 -4.64E+00
Skin cancer 2C30-2C3Z Skin 4.60E-01 4.08E-02 7.25E-02
Thrombocythemia 3B63 Whole blood 4.47E-01 1.07E-01 3.78E-01
Thrombocytopenia 3B64 Whole blood 1.93E-01 2.85E-01 9.49E-01
Thyroid cancer 2D10 Thyroid 5.09E-31 6.05E-01 1.83E+00
Tibial muscular dystrophy 8C75 Muscle tissue 4.20E-02 -3.78E-01 -9.34E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.71E-01 -3.41E-01 -8.87E-01
Type 2 diabetes 5A11 Liver tissue 3.77E-01 -4.81E-02 -2.64E-01
Ureter cancer 2C92 Urothelium 4.29E-01 -1.98E-02 -2.89E-02
Uterine cancer 2C78 Endometrium tissue 7.80E-01 -7.08E-02 -1.52E-01
Vitiligo ED63.0 Skin 3.40E-01 1.42E-01 7.51E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases