General Information of Drug Transporter (DTP) (ID: DTLMZUF)

DTP Name ATP-binding cassette sub-family A member 6 (ABCA6)
Gene Name ABCA6
UniProt ID
Q8N139 (ABCA6_HUMAN)
VARIDT ID
DTD0044
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ABCA6; EST155051; ATP-binding cassette A member 6
DTP Family ATP-Binding Cassette (ABC) Superfamily ;
Tissue Specificity Widely expressed with higher expression inliver.
Sequence
MNMKQKSVYQQTKALLCKNFLKKWRMKRESLLEWGLSILLGLCIALFSSSMRNVQFPGMA
PQNLGRVDKFNSSSLMVVYTPISNLTQQIMNKTALAPLLKGTSVIGAPNKTHMDEILLEN
LPYAMGIIFNETFSYKLIFFQGYNSPLWKEDFSAHCWDGYGEFSCTLTKYWNRGFVALQT
AINTAIIEITTNHPVMEELMSVTAITMKTLPFITKNLLHNEMFILFFLLHFSPLVYFISL
NVTKERKKSKNLMKMMGLQDSAFWLSWGLIYAGFIFIISIFVTIIITFTQIIVMTGFMVI
FILFFLYGLSLVALVFLMSVLLKKAVLTNLVVFLLTLFWGCLGFTVFYEQLPSSLEWILN
ICSPFAFTTGMIQIIKLDYNLNGVIFPDPSGDSYTMIATFSMLLLDGLIYLLLALYFDKI
LPYGDERHYSPLFFLNSSSCFQHQRTNAKVIEKEIDAEHPSDDYFEPVAPEFQGKEAIRI
RNVKKEYKGKSGKVEALKGLLFDIYEGQITAILGHSGAGKSSLLNILNGLSVPTEGSVTI
YNKNLSEMQDLEEIRKITGVCPQFNVQFDILTVKENLSLFAKIKGIHLKEVEQEVQRILL
ELDMQNIQDNLAKHLSEGQKRKLTFGITILGDPQILLLDEPTTGLDPFSRDQVWSLLRER
RADHVILFSTQSMDEADILADRKVIMSNGRLKCAGSSMFLKRRWGLGYHLSLHRNEICNP
EQITSFITHHIPDAKLKTENKEKLVYTLPLERTNTFPDLFSDLDKCSDQGVTGYDISMST
LNEVFMKLEGQSTIEQDFEQVEMIRDSESLNEMELAHSSFSEMQTAVSDMGLWRMQVFAM
ARLRFLKLKRQTKVLLTLLLVFGIAIFPLIVENIMYAMLNEKIDWEFKNELYFLSPGQLP
QEPRTSLLIINNTESNIEDFIKSLKHQNILLEVDDFENRNGTDGLSYNGAIIVSGKQKDY
RFSVVCNTKRLHCFPILMNIISNGLLQMFNHTQHIRIESSPFPLSHIGLWTGLPDGSFFL
FLVLCSISPYITMGSISDYKKNAKSQLWISGLYTSAYWCGQALVDVSFFILILLLMYLIF
YIENMQYLLITSQIVFALVIVTPGYAASLVFFIYMISFIFRKRRKNSGLWSFYFFFASTI
MFSITLINHFDLSILITTMVLVPSYTLLGFKTFLEVRDQEHYREFPEANFELSATDFLVC
FIPYFQTLLFVFVLRCMELKCGKKRMRKDPVFRISPQSRDAKPNPEEPIDEDEDIQTERI
RTATALTTSILDEKPVIIASCLHKEYAGQKKSCFSKRKKKIAARNISFCVQEGEILGLLG
PNGAGKSSSIRMISGITKPTAGEVELKGCSSVLGHLGYCPQENVLWPMLTLREHLEVYAA
VKGLRKADARLAIARLVSAFKLHEQLNVPVQKLTAGITRKLCFVLSLLGNSPVLLLDEPS
TGIDPTGQQQMWQAIQAVVKNTERGVLLTTHNLAEAEALCDRVAIMVSGRLRCIGSIQHL
KNKLGKDYILELKVKETSQVTLVHTEILKLFPQAAGQERYSSLLTYKLPVADVYPLSQTF
HKLEAVKHNFNLEEYSLSQCTLEKVFLELSKEQEVGNFDEEIDTTMRWKLLPHSDEP
Function This transporter is probable transporter which may play a role in macrophage lipid homeostasis.
Endogenous Substrate(s) Lipids
TCDB ID
3.A.1.211.15
Gene ID
23460
KEGG Pathway
ABC transporters (hsa02010 )
Reactome Pathway
FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes (R-HSA-9615017 )
ABC transporters in lipid homeostasis (R-HSA-1369062 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.00E-05 8.78E-02 6.73E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.71E-09 -1.37E+00 -2.87E+00
Alopecia ED70 Skin from scalp 5.78E-05 5.35E-01 1.08E+00
Alzheimer's disease 8A20 Entorhinal cortex 4.13E-05 3.80E-01 6.20E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.07E-01 -6.23E-01 -5.25E-01
Aortic stenosis BB70 Calcified aortic valve 5.94E-01 -7.88E-02 -4.43E-02
Apnea 7A40 Hyperplastic tonsil 2.09E-01 1.06E-01 7.14E-01
Arthropathy FA00-FA5Z Peripheral blood 6.19E-01 -4.28E-02 -2.55E-01
Asthma CA23 Nasal and bronchial airway 9.94E-06 -3.92E-01 -3.33E-01
Atopic dermatitis EA80 Skin 1.58E-08 -8.52E-01 -3.02E+00
Autism 6A02 Whole blood 2.20E-03 -7.75E-02 -3.97E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.38E-01 -1.95E-01 -1.07E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.58E-01 -7.89E-03 -5.60E-02
Bacterial infection of gingival 1C1H Gingival tissue 4.35E-02 1.43E-01 3.37E-01
Batten disease 5C56.1 Whole blood 7.12E-01 -1.87E-01 -1.51E+00
Behcet's disease 4A62 Peripheral blood 8.03E-01 8.68E-02 3.15E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.89E-01 -5.56E-02 -1.66E-01
Bladder cancer 2C94 Bladder tissue 6.55E-12 -1.84E+00 -7.13E+00
Breast cancer 2C60-2C6Z Breast tissue 2.45E-96 -2.41E+00 -2.29E+00
Cardioembolic stroke 8B11.20 Whole blood 2.36E-04 3.15E-01 7.27E-01
Cervical cancer 2C77 Cervical tissue 2.91E-01 -7.67E-02 -1.57E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.44E-01 6.42E-02 3.55E-01
Chronic hepatitis C 1E51.1 Whole blood 8.67E-01 1.14E-02 1.07E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.40E-01 -1.10E-02 -2.81E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.24E-01 5.59E-02 3.07E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.26E-01 3.11E-01 7.09E-01
Colon cancer 2B90 Colon tissue 7.19E-25 -5.15E-01 -1.22E+00
Coronary artery disease BA80-BA8Z Peripheral blood 3.93E-01 -1.48E-02 -1.04E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.03E-01 3.10E-01 3.25E-01
Endometriosis GA10 Endometrium tissue 2.11E-04 2.95E-01 3.19E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.75E-01 -8.01E-04 -6.28E-03
Familial hypercholesterolemia 5C80.00 Whole blood 3.78E-01 9.46E-02 5.49E-01
Gastric cancer 2B72 Gastric tissue 2.52E-01 -7.27E-01 -8.60E-01
Glioblastopma 2A00.00 Nervous tissue 4.04E-12 -2.83E-01 -3.78E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.44E-02 -2.49E-01 -5.04E-01
Head and neck cancer 2D42 Head and neck tissue 2.84E-02 -8.07E-02 -1.12E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.24E-01 -2.05E-01 -3.53E-01
Huntington's disease 8A01.10 Whole blood 8.34E-01 -8.97E-02 -5.62E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.00E-01 -5.17E-01 -9.37E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.25E-01 -5.66E-02 -2.83E-01
Influenza 1.00E+30 Whole blood 8.62E-01 -2.25E-01 -3.70E-01
Interstitial cystitis GC00.3 Bladder tissue 1.35E-03 -7.87E-01 -3.31E+00
Intracranial aneurysm 8B01.0 Intracranial artery 8.01E-04 -1.50E+00 -2.46E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.54E-01 -1.24E-01 -2.21E-01
Ischemic stroke 8B11 Peripheral blood 3.76E-01 -2.97E-02 -1.60E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.92E-01 2.35E-02 5.70E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 1.05E-01 -1.05E-01 -2.70E-01
Lateral sclerosis 8B60.4 Skin 5.65E-01 -5.88E-02 -8.36E-02
Liver cancer 2C12.0 Liver tissue 5.74E-26 -9.31E-01 -1.76E+00
Liver failure DB99.7-DB99.8 Liver tissue 8.98E-07 -2.93E+00 -4.94E+00
Lung cancer 2C25 Lung tissue 5.42E-89 -1.85E+00 -2.84E+00
Lupus erythematosus 4A40 Whole blood 7.74E-02 -3.72E-02 -1.34E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.47E-01 9.62E-02 3.76E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.82E-02 -7.88E-02 -2.71E-01
Melanoma 2C30 Skin 3.26E-02 -1.02E+00 -7.88E-01
Multiple myeloma 2A83.1 Bone marrow 2.03E-03 -6.76E-01 -2.36E+00
Multiple myeloma 2A83.1 Peripheral blood 1.82E-01 6.15E-02 3.40E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.36E-01 3.47E-02 5.67E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.58E-01 2.04E-02 1.03E-01
Myelofibrosis 2A20.2 Whole blood 1.95E-01 9.83E-02 4.81E-01
Myocardial infarction BA41-BA50 Peripheral blood 4.42E-02 1.35E-01 3.86E-01
Myopathy 8C70.6 Muscle tissue 8.87E-02 2.69E-01 6.41E-01
Neonatal sepsis KA60 Whole blood 2.21E-01 4.96E-02 2.87E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.03E-05 -1.77E+00 -2.29E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.78E-02 -2.93E-01 -1.25E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.78E-01 1.71E-01 2.19E-01
Olive pollen allergy CA08.00 Peripheral blood 3.77E-01 -2.09E-02 -9.94E-02
Oral cancer 2B6E Oral tissue 8.38E-04 -6.72E-01 -9.45E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.96E-01 -5.75E-01 -4.16E-01
Osteoporosis FB83.1 Bone marrow 3.39E-01 -3.08E-02 -4.50E-02
Ovarian cancer 2C73 Ovarian tissue 3.70E-04 -3.68E+00 -2.59E+00
Pancreatic cancer 2C10 Pancreas 6.51E-01 1.49E-01 1.59E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.68E-01 3.33E-01 6.90E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.99E-01 -3.68E-02 -2.34E-01
Pituitary cancer 2D12 Pituitary tissue 4.02E-03 -4.51E-01 -1.24E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.38E-03 -4.97E-01 -1.21E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.96E-01 -3.42E-02 -1.16E-01
Polycythemia vera 2A20.4 Whole blood 1.11E-04 1.32E-01 6.60E-01
Pompe disease 5C51.3 Biceps muscle 9.86E-02 3.32E-01 7.16E-01
Preterm birth KA21.4Z Myometrium 7.08E-01 8.44E-02 1.43E-01
Prostate cancer 2C82 Prostate 8.84E-01 4.36E-01 2.94E-01
Psoriasis EA90 Skin 5.50E-04 -3.56E-01 -4.14E-01
Rectal cancer 2B92 Rectal colon tissue 6.30E-02 -7.40E-01 -1.26E+00
Renal cancer 2C90-2C91 Kidney 1.29E-01 -4.63E-01 -1.06E+00
Retinoblastoma 2D02.2 Uvea 5.66E-01 -9.35E-02 -5.15E-01
Rheumatoid arthritis FA20 Synovial tissue 2.70E-02 6.58E-01 5.84E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.95E-01 2.89E-02 2.64E-01
Schizophrenia 6A20 Prefrontal cortex 7.46E-01 3.10E-02 1.01E-01
Schizophrenia 6A20 Superior temporal cortex 6.86E-01 7.94E-03 2.55E-02
Scleroderma 4A42.Z Whole blood 6.00E-01 1.44E-02 8.69E-02
Seizure 8A60-8A6Z Whole blood 8.27E-01 -1.20E-01 -7.49E-01
Sensitive skin EK0Z Skin 5.71E-01 -3.35E-01 -1.01E+00
Sepsis with septic shock 1G41 Whole blood 8.02E-01 -1.07E-02 -4.98E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 7.95E-01 -1.25E-01 -4.03E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.50E-01 8.39E-02 4.02E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.74E-01 -2.34E-01 -1.60E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.00E-01 1.50E-01 2.53E-01
Skin cancer 2C30-2C3Z Skin 2.37E-47 -1.87E+00 -2.11E+00
Thrombocythemia 3B63 Whole blood 6.93E-03 2.08E-01 9.69E-01
Thrombocytopenia 3B64 Whole blood 7.32E-01 6.59E-01 1.25E+00
Thyroid cancer 2D10 Thyroid 1.03E-19 -9.43E-01 -1.89E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.39E-04 8.74E-01 1.35E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 6.63E-01 -1.95E-01 -1.76E+00
Type 2 diabetes 5A11 Liver tissue 7.64E-01 -8.73E-03 -2.23E-02
Ureter cancer 2C92 Urothelium 1.87E-02 1.32E-01 1.20E+00
Uterine cancer 2C78 Endometrium tissue 4.74E-03 -1.16E-01 -1.53E-01
Vitiligo ED63.0 Skin 2.12E-01 -1.67E-01 -3.39E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases