Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTMALXP)

DTP Name UDP-xylose and UDP-N-acetylglucosamine transporter (SLC35B4)
Gene Name SLC35B4
UniProt ID
Q969S0 (S35B4_HUMAN)
VARIDT ID
DTD0295
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC35B4; Solute carrier family 35 member B4; YEA; YEA4; YEA4 homolog
DTP Family Drug/Metabolite Transporter (DMT) Superfamily
UDP-N-Acetylglucosamine:UMP Antiporter (UAA) Family
Sequence
MRPALAVGLVFAGCCSNVIFLELLARKHPGCGNIVTFAQFLFIAVEGFLFEADLGRKPPA
IPIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSIFK
YTSIALVSVGIFICTFMSAKQVTSQSSLSENDGFQAFVWWLLGIGALTFALLMSARMGIF
QETLYKRFGKHSKEALFYNHALPLPGFVFLASDIYDHAVLFNKSELYEIPVIGVTLPIMW
FYLLMNIITQYVCIRGVFILTTECASLTVTLVVTLRKFVSLIFSILYFQNPFTLWHWLGT
LFVFIGTLMYTEVWNNLGTTKSEPQKDSKKN
Function This transporter specifically mediates the transport of UDP-xylose (UDP-Xyl) and UDP-N-acetylglucosamine (UDP-GlcNAc) from cytosol into Golgi.
Endogenous Substrate(s) UDP-N-acetylglucosamine
TCDB ID
2.A.7.10.2
Gene ID
84912
Reactome Pathway
Transport of nucleotide sugars (R-HSA-727802 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
UDP-xylose DMVE7MZ Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.15E-08 9.92E-02 3.08E-01
Adrenocortical carcinoma 2D11.Z Kidney 4.27E-03 3.42E-01 9.85E-01
Alopecia ED70 Skin from scalp 8.23E-02 -1.28E-01 -2.84E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.96E-03 -1.13E-01 -3.55E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.08E-01 1.10E-01 3.97E-01
Aortic stenosis BB70 Calcified aortic valve 6.91E-01 -2.40E-02 -1.63E-01
Apnea 7A40 Hyperplastic tonsil 2.75E-01 -1.09E-01 -4.71E-01
Arthropathy FA00-FA5Z Peripheral blood 8.27E-02 -2.00E-01 -1.04E+00
Asthma CA23 Nasal and bronchial airway 3.36E-03 6.03E-02 8.84E-02
Atopic dermatitis EA80 Skin 8.97E-01 -7.65E-02 -2.68E-01
Autism 6A02 Whole blood 4.96E-01 2.72E-02 1.11E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.51E-02 2.53E-01 1.45E+00
Autosomal dominant monocytopenia 4B04 Whole blood 5.94E-01 -1.86E-01 -9.39E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.90E-01 -1.56E-02 -6.57E-02
Batten disease 5C56.1 Whole blood 9.54E-01 6.67E-02 5.66E-01
Behcet's disease 4A62 Peripheral blood 1.68E-02 -2.01E-01 -1.20E+00
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.50E-01 1.62E-02 5.65E-02
Bladder cancer 2C94 Bladder tissue 9.90E-04 -2.64E-01 -1.79E+00
Breast cancer 2C60-2C6Z Breast tissue 2.68E-12 -2.71E-01 -6.17E-01
Cardioembolic stroke 8B11.20 Whole blood 9.82E-01 5.09E-02 2.73E-01
Cervical cancer 2C77 Cervical tissue 2.98E-02 1.58E-01 7.42E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.76E-01 1.80E-01 2.19E-01
Chronic hepatitis C 1E51.1 Whole blood 2.67E-01 -1.22E-01 -5.23E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.84E-01 -7.17E-02 -1.75E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.49E-01 -4.76E-02 -1.78E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.08E-01 3.63E-02 9.16E-02
Colon cancer 2B90 Colon tissue 7.50E-55 4.43E-01 1.73E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.47E-01 -1.44E-01 -1.33E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.07E-01 -5.01E-02 -1.25E-01
Endometriosis GA10 Endometrium tissue 3.28E-01 2.06E-01 3.35E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.81E-01 -1.85E-02 -1.11E-01
Familial hypercholesterolemia 5C80.00 Whole blood 5.74E-08 4.65E-01 1.71E+00
Gastric cancer 2B72 Gastric tissue 4.62E-01 1.66E-01 6.23E-01
Glioblastopma 2A00.00 Nervous tissue 1.13E-05 1.22E-01 2.55E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.15E-02 2.78E-01 6.35E-01
Head and neck cancer 2D42 Head and neck tissue 4.85E-24 5.75E-01 1.73E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.22E-01 -9.22E-02 -2.32E-01
Huntington's disease 8A01.10 Whole blood 4.54E-01 -3.88E-02 -1.52E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.90E-03 3.91E-01 2.26E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.34E-02 -1.80E-01 -1.66E+00
Influenza 1.00E+30 Whole blood 2.06E-01 -2.84E-01 -1.46E+00
Interstitial cystitis GC00.3 Bladder tissue 5.82E-01 1.09E-02 1.17E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.37E-02 3.32E-01 1.08E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.24E-01 1.54E-02 4.99E-02
Ischemic stroke 8B11 Peripheral blood 7.87E-03 -3.06E-01 -1.18E+00
Juvenile idiopathic arthritis FA24 Peripheral blood 4.81E-01 8.40E-03 2.50E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 3.39E-01 1.48E-01 4.35E-01
Lateral sclerosis 8B60.4 Skin 7.71E-01 -1.36E-01 -4.25E-01
Liver cancer 2C12.0 Liver tissue 7.07E-03 2.59E-01 4.26E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.98E-02 -2.78E-01 -1.88E+00
Lung cancer 2C25 Lung tissue 3.26E-01 -3.88E-02 -1.07E-01
Lupus erythematosus 4A40 Whole blood 4.00E-01 1.46E-01 1.60E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.89E-01 2.92E-04 9.11E-04
Major depressive disorder 6A70-6A7Z Hippocampus 3.73E-01 3.13E-03 1.24E-02
Melanoma 2C30 Skin 1.77E-02 3.49E-01 3.31E-01
Multiple myeloma 2A83.1 Bone marrow 8.04E-01 2.67E-02 1.71E-01
Multiple myeloma 2A83.1 Peripheral blood 6.19E-01 -2.20E-01 -5.46E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.00E-01 2.07E-03 9.54E-03
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.44E-01 6.18E-03 1.23E-02
Myelofibrosis 2A20.2 Whole blood 6.83E-01 4.99E-03 3.41E-02
Myocardial infarction BA41-BA50 Peripheral blood 4.16E-02 -9.54E-01 -1.11E+00
Myopathy 8C70.6 Muscle tissue 1.13E-01 1.76E-01 1.17E+00
Neonatal sepsis KA60 Whole blood 3.42E-03 -1.37E-01 -4.18E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.41E-05 7.80E-01 2.48E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.29E-02 -1.62E-01 -1.08E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.16E-02 2.72E-01 9.96E-01
Olive pollen allergy CA08.00 Peripheral blood 7.24E-01 1.05E-01 1.95E-01
Oral cancer 2B6E Oral tissue 3.57E-04 3.49E-01 7.59E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.12E-01 5.99E-01 9.15E-01
Osteoporosis FB83.1 Bone marrow 7.43E-01 2.86E-01 9.55E-01
Ovarian cancer 2C73 Ovarian tissue 1.82E-01 -6.54E-01 -7.67E-01
Pancreatic cancer 2C10 Pancreas 8.67E-01 -5.57E-03 -1.83E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 2.56E-01 8.05E-02 2.44E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.42E-01 -1.04E-01 -5.21E-01
Pituitary cancer 2D12 Pituitary tissue 3.83E-01 -1.53E-01 -3.61E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.45E-02 -4.13E-01 -1.48E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.13E-01 -3.39E-02 -1.97E-01
Polycythemia vera 2A20.4 Whole blood 6.99E-04 -7.08E-02 -4.85E-01
Pompe disease 5C51.3 Biceps muscle 5.25E-04 4.98E-01 1.62E+00
Preterm birth KA21.4Z Myometrium 6.76E-02 -3.84E-01 -1.43E+00
Prostate cancer 2C82 Prostate 3.80E-05 1.12E+00 1.50E+00
Psoriasis EA90 Skin 7.18E-08 2.04E-01 4.10E-01
Rectal cancer 2B92 Rectal colon tissue 2.72E-02 2.08E-01 8.95E-01
Renal cancer 2C90-2C91 Kidney 1.55E-01 -7.42E-02 -3.46E-01
Retinoblastoma 2D02.2 Uvea 1.83E-01 -2.87E-01 -1.23E+00
Rheumatoid arthritis FA20 Synovial tissue 4.60E-04 8.06E-01 2.36E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.89E-02 8.62E-02 4.68E-01
Schizophrenia 6A20 Prefrontal cortex 2.72E-02 -3.01E-01 -4.21E-01
Schizophrenia 6A20 Superior temporal cortex 6.29E-01 1.58E-02 6.12E-02
Scleroderma 4A42.Z Whole blood 1.33E-02 2.06E-01 1.07E+00
Seizure 8A60-8A6Z Whole blood 9.73E-01 -1.93E-02 -5.81E-02
Sensitive skin EK0Z Skin 7.16E-01 -2.03E-02 -2.46E-01
Sepsis with septic shock 1G41 Whole blood 2.35E-07 -1.62E-01 -5.42E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.71E-01 1.50E-02 4.41E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.43E-01 3.37E-01 1.82E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 1.72E-03 -4.21E-01 -4.76E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.48E-01 -1.22E-01 -3.44E-01
Skin cancer 2C30-2C3Z Skin 6.32E-68 1.50E+00 2.66E+00
Thrombocythemia 3B63 Whole blood 2.61E-01 -8.69E-02 -6.13E-01
Thrombocytopenia 3B64 Whole blood 2.10E-01 -8.09E-01 -6.76E-01
Thyroid cancer 2D10 Thyroid 9.88E-01 -6.63E-02 -2.55E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.51E-03 4.35E-01 2.04E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.06E-02 -3.68E-01 -2.32E+00
Type 2 diabetes 5A11 Liver tissue 5.16E-05 -6.57E-01 -3.98E+00
Ureter cancer 2C92 Urothelium 2.63E-01 -1.70E-01 -6.43E-01
Uterine cancer 2C78 Endometrium tissue 2.78E-03 -2.09E-01 -6.72E-01
Vitiligo ED63.0 Skin 9.13E-01 -4.47E-02 -1.85E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 The human solute carrier gene SLC35B4 encodes a bifunctional nucleotide sugar transporter with specificity for UDP-xylose and UDP-N-acetylglucosamine. J Biol Chem. 2005 Jul 22;280(29):27230-5.