Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTN0JXW)

DTP Name Sodium/hydrogen exchanger 6 (SLC9A6)
Gene Name SLC9A6
UniProt ID
Q92581 (SL9A6_HUMAN)
VARIDT ID
DTD0490
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms KIAA0267; MRSA; NHE-6; NHE6; Na(+)/H(+) exchanger 6; SLC9A6; Solute carrier family 9 member 6
DTP Family Monovalent Cation:Proton Antiporter-1 (CPA1) family ;
Tissue Specificity Ubiquitous; but is most abundant inmitochondrion-rich tissues such as brain, skeletal muscle andheart.
Sequence
MARRGWRRAPLRRGVGSSPRARRLMRPLWLLLAVGVFDWAGASDGGGGEARAMDEEIVSE
KQAEESHRQDSANLLIFILLLTLTILTIWLFKHRRARFLHETGLAMIYGLLVGLVLRYGI
HVPSDVNNVTLSCEVQSSPTTLLVTFDPEVFFNILLPPIIFYAGYSLKRRHFFRNLGSIL
AYAFLGTAISCFVIGSIMYGCVTLMKVTGQLAGDFYFTDCLLFGAIVSATDPVTVLAIFH
ELQVDVELYALLFGESVLNDAVAIVLSSSIVAYQPAGDNSHTFDVTAMFKSIGIFLGIFS
GSFAMGAATGVVTALVTKFTKLREFQLLETGLFFLMSWSTFLLAEAWGFTGVVAVLFCGI
TQAHYTYNNLSTESQHRTKQLFELLNFLAENFIFSYMGLTLFTFQNHVFNPTFVVGAFVA
IFLGRAANIYPLSLLLNLGRRSKIGSNFQHMMMFAGLRGAMAFALAIRDTATYARQMMFS
TTLLIVFFTVWVFGGGTTAMLSCLHIRVGVDSDQEHLGVPENERRTTKAESAWLFRMWYN
FDHNYLKPLLTHSGPPLTTTLPACCGPIARCLTSPQAYENQEQLKDDDSDLILNDGDISL
TYGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNL
LDNTRHGPA
Function This electroneutral transporter of protons for Na(+) and K(+) across the early and recycling endosome membranes. It contributes to calcium homeostasis.
Endogenous Substrate(s) Na+; H+
TCDB ID
2.A.36.1.14
Gene ID
10479
KEGG Pathway
Cardiac muscle contraction (hsa04260 )
Reactome Pathway
Defective SLC9A6 causes X-linked, syndromic mental retardation, Christianson type (MRXSCH) (R-HSA-5619092 )
Sodium/Proton exchangers (R-HSA-425986 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.25E-01 -4.22E-03 -9.52E-03
Adrenocortical carcinoma 2D11.Z Kidney 1.11E-02 1.75E-01 4.00E-01
Alopecia ED70 Skin from scalp 2.80E-01 4.42E-02 2.36E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.04E-04 -1.81E-01 -5.42E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.19E-01 -3.05E-02 -1.90E-01
Aortic stenosis BB70 Calcified aortic valve 7.40E-01 -7.02E-03 -9.21E-03
Apnea 7A40 Hyperplastic tonsil 7.44E-01 -1.35E-02 -3.46E-02
Arthropathy FA00-FA5Z Peripheral blood 4.80E-01 -5.78E-02 -2.07E-01
Asthma CA23 Nasal and bronchial airway 2.82E-06 4.61E-01 6.54E-01
Atopic dermatitis EA80 Skin 3.34E-03 -8.78E-02 -6.17E-01
Autism 6A02 Whole blood 6.61E-01 2.69E-02 7.48E-02
Autoimmune uveitis 9A96 Peripheral monocyte 2.34E-01 4.68E-01 1.71E+00
Autosomal dominant monocytopenia 4B04 Whole blood 3.83E-02 3.70E-01 1.12E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.10E-07 -2.66E-01 -9.17E-01
Batten disease 5C56.1 Whole blood 8.24E-01 -2.37E-02 -1.22E-01
Behcet's disease 4A62 Peripheral blood 3.20E-01 -2.41E-02 -1.49E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.37E-01 -3.89E-02 -2.65E-01
Bladder cancer 2C94 Bladder tissue 4.22E-14 -5.33E-01 -6.94E+00
Breast cancer 2C60-2C6Z Breast tissue 4.21E-36 -6.23E-01 -9.94E-01
Cardioembolic stroke 8B11.20 Whole blood 8.55E-07 3.38E-01 1.97E+00
Cervical cancer 2C77 Cervical tissue 8.69E-03 2.01E-01 7.70E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.12E-01 -1.15E-01 -2.24E-01
Chronic hepatitis C 1E51.1 Whole blood 4.24E-02 -1.50E-01 -9.86E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.13E-01 1.46E-02 6.19E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.39E-05 -2.70E-01 -8.09E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 7.69E-01 2.75E-02 8.42E-02
Colon cancer 2B90 Colon tissue 1.70E-02 4.59E-02 1.54E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.16E-01 3.31E-01 4.45E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.38E-01 -3.52E-01 -4.58E-01
Endometriosis GA10 Endometrium tissue 7.89E-01 -2.91E-02 -4.02E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.86E-01 1.26E-02 7.86E-02
Familial hypercholesterolemia 5C80.00 Whole blood 1.10E-06 4.92E-01 1.22E+00
Gastric cancer 2B72 Gastric tissue 1.83E-01 2.71E-01 9.21E-01
Glioblastopma 2A00.00 Nervous tissue 3.05E-127 -1.41E+00 -2.14E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.38E-01 3.99E-01 1.12E+00
Head and neck cancer 2D42 Head and neck tissue 7.90E-09 2.36E-01 7.04E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.22E-01 -2.89E-01 -3.65E-01
Huntington's disease 8A01.10 Whole blood 6.23E-01 -6.31E-02 -1.68E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.81E-01 1.18E-01 4.18E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.28E-03 -1.31E-01 -1.07E+00
Influenza 1.00E+30 Whole blood 6.88E-04 -1.32E+00 -7.89E+00
Interstitial cystitis GC00.3 Bladder tissue 2.06E-03 -3.04E-01 -3.81E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.81E-01 -6.78E-02 -2.45E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.26E-01 -3.08E-02 -1.94E-01
Ischemic stroke 8B11 Peripheral blood 6.94E-02 -1.31E-01 -9.21E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.02E-02 -5.33E-02 -1.23E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.59E-01 -1.08E-01 -1.15E-01
Lateral sclerosis 8B60.4 Skin 5.26E-01 2.03E-02 6.07E-02
Liver cancer 2C12.0 Liver tissue 2.01E-16 7.91E-01 2.11E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.88E-01 7.29E-02 2.21E-01
Lung cancer 2C25 Lung tissue 2.11E-02 2.29E-02 7.66E-02
Lupus erythematosus 4A40 Whole blood 1.04E-01 2.75E-01 3.86E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.81E-01 1.49E-01 3.08E-01
Major depressive disorder 6A70-6A7Z Hippocampus 4.62E-02 2.34E-02 1.64E-01
Melanoma 2C30 Skin 7.18E-01 5.99E-02 1.22E-01
Multiple myeloma 2A83.1 Bone marrow 2.54E-06 8.87E-01 3.71E+00
Multiple myeloma 2A83.1 Peripheral blood 6.66E-01 -4.11E-02 -2.78E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.62E-01 -3.16E-02 -1.04E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.01E-03 -4.32E-01 -9.88E-01
Myelofibrosis 2A20.2 Whole blood 9.10E-01 -7.94E-02 -2.84E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.56E-03 -5.06E-01 -7.53E-01
Myopathy 8C70.6 Muscle tissue 5.94E-01 -6.72E-02 -2.84E-01
Neonatal sepsis KA60 Whole blood 7.16E-09 2.66E-01 6.25E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.15E-01 -7.66E-02 -2.12E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 6.86E-01 -1.63E-02 -4.89E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.14E-01 -9.49E-02 -3.15E-01
Olive pollen allergy CA08.00 Peripheral blood 7.92E-01 -3.20E-01 -6.18E-01
Oral cancer 2B6E Oral tissue 5.80E-04 3.43E-01 4.63E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.01E-01 -1.40E-01 -2.91E-01
Osteoporosis FB83.1 Bone marrow 1.29E-02 -6.06E-01 -3.60E+00
Ovarian cancer 2C73 Ovarian tissue 1.59E-01 3.20E-01 4.98E-01
Pancreatic cancer 2C10 Pancreas 1.12E-03 4.37E-01 1.06E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 6.68E-01 -4.06E-01 -5.13E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.11E-02 4.89E-02 5.14E-01
Pituitary cancer 2D12 Pituitary tissue 2.09E-01 2.53E-01 4.88E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.16E-01 2.05E-01 4.14E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.52E-01 8.28E-02 2.56E-01
Polycythemia vera 2A20.4 Whole blood 4.89E-01 5.60E-03 1.84E-02
Pompe disease 5C51.3 Biceps muscle 6.23E-01 -2.43E-02 -2.63E-01
Preterm birth KA21.4Z Myometrium 8.52E-01 -7.54E-02 -2.51E-01
Prostate cancer 2C82 Prostate 1.77E-01 1.11E+00 9.09E-01
Psoriasis EA90 Skin 8.02E-08 1.52E-01 5.11E-01
Rectal cancer 2B92 Rectal colon tissue 7.11E-02 -1.65E-01 -9.24E-01
Renal cancer 2C90-2C91 Kidney 6.00E-02 4.10E-01 7.23E-01
Retinoblastoma 2D02.2 Uvea 1.89E-06 -1.28E+00 -4.77E+00
Rheumatoid arthritis FA20 Synovial tissue 6.21E-01 -4.00E-01 -7.23E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.29E-01 1.58E-02 8.74E-02
Schizophrenia 6A20 Prefrontal cortex 5.08E-02 -1.84E-01 -1.88E-01
Schizophrenia 6A20 Superior temporal cortex 3.69E-01 3.71E-02 8.52E-02
Scleroderma 4A42.Z Whole blood 2.11E-01 7.30E-02 7.27E-01
Seizure 8A60-8A6Z Whole blood 3.40E-01 -2.15E-02 -8.69E-02
Sensitive skin EK0Z Skin 6.65E-01 -3.32E-02 -6.30E-01
Sepsis with septic shock 1G41 Whole blood 1.54E-11 1.50E-01 4.47E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.07E-01 -3.84E-01 -9.05E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.74E-03 -1.17E+00 -1.54E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.57E-01 -2.01E-01 -5.87E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.21E-02 4.99E-01 2.34E+00
Skin cancer 2C30-2C3Z Skin 3.40E-03 -1.58E-01 -4.56E-01
Thrombocythemia 3B63 Whole blood 2.70E-02 -2.06E-01 -7.12E-01
Thrombocytopenia 3B64 Whole blood 1.96E-01 -1.36E+00 -1.16E+00
Thyroid cancer 2D10 Thyroid 1.58E-09 -2.08E-01 -9.69E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.92E-03 -2.97E-01 -8.66E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.40E-02 -6.26E-01 -4.44E+00
Type 2 diabetes 5A11 Liver tissue 6.76E-02 6.14E-01 1.39E+00
Ureter cancer 2C92 Urothelium 9.44E-01 -5.92E-02 -9.92E-02
Uterine cancer 2C78 Endometrium tissue 5.39E-28 6.86E-01 1.18E+00
Vitiligo ED63.0 Skin 1.31E-01 4.38E-02 5.53E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases