Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTN1FMD)

DTP Name Chloride anion exchanger (SLC26A3)
Gene Name SLC26A3
UniProt ID
P40879 (S26A3_HUMAN)
VARIDT ID
DTD0231
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms CLD; DRA; Down-regulated in adenoma; Protein DRA; SLC26A3; Solute carrier family 26 member 3
DTP Family Sulfate Permease (SULP) Family ;
Sequence
MIEPFGNQYIVARPVYSTNAFEENHKKTGRHHKTFLDHLKVCCSCSPQKAKRIVLSLFPI
ASWLPAYRLKEWLLSDIVSGISTGIVAVLQGLAFALLVDIPPVYGLYASFFPAIIYLFFG
TSRHISVGPFPILSMMVGLAVSGAVSKAVPDRNATTLGLPNNSNNSSLLDDERVRVAAAA
SVTVLSGIIQLAFGILRIGFVVIYLSESLISGFTTAAAVHVLVSQLKFIFQLTVPSHTDP
VSIFKVLYSVFSQIEKTNIADLVTALIVLLVVSIVKEINQRFKDKLPVPIPIEFIMTVIA
AGVSYGCDFKNRFKVAVVGDMNPGFQPPITPDVETFQNTVGDCFGIAMVAFAVAFSVASV
YSLKYDYPLDGNQELIALGLGNIVCGVFRGFAGSTALSRSAVQESTGGKTQIAGLIGAII
VLIVVLAIGFLLAPLQKSVLAALALGNLKGMLMQFAEIGRLWRKDKYDCLIWIMTFIFTI
VLGLGLGLAASVAFQLLTIVFRTQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRC
PSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDT
IKDSDEELDNNQIEVLDQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAVSFLD
VSSVRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKSSIFFLTIHDAVLHI
LMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF
Function
This transporter mediates the efficient absorption of chloride ions in the colon, participating in fluid homeostasis. Plays a role in the chloride and bicarbonate homeostasis during sperm epididymal maturation and capacitation.
Endogenous Substrate(s) Cl-
TCDB ID
2.A.53.2.18
Gene ID
1811
KEGG Pathway
Pancreatic secretion (hsa04972 )
Mineral absorption (hsa04978 )
Reactome Pathway
Defective SLC26A3 causes congenital secretory chloride diarrhea 1 (DIAR1) (R-HSA-5619085 )
Multifunctional anion exchangers (R-HSA-427601 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.54E-04 -4.03E-02 -3.66E-01
Adrenocortical carcinoma 2D11.Z Kidney 2.93E-01 -6.46E-04 -6.27E-03
Alopecia ED70 Skin from scalp 4.13E-03 1.92E-01 3.51E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.40E-01 -1.48E-02 -1.57E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 2.44E-01 -5.61E-03 -5.64E-02
Aortic stenosis BB70 Calcified aortic valve 7.50E-01 3.47E-02 1.02E-01
Apnea 7A40 Hyperplastic tonsil 8.60E-01 -4.93E-02 -6.17E-01
Arthropathy FA00-FA5Z Peripheral blood 7.00E-01 -1.55E-02 -1.63E-01
Asthma CA23 Nasal and bronchial airway 8.38E-02 -1.25E-02 -7.12E-02
Atopic dermatitis EA80 Skin 1.69E-01 -2.08E-01 -2.74E-01
Autism 6A02 Whole blood 1.39E-01 -5.28E-02 -3.70E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.69E-01 2.87E-02 1.45E-01
Autosomal dominant monocytopenia 4B04 Whole blood 4.84E-01 4.69E-02 3.32E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.94E-01 -2.20E-02 -2.48E-01
Batten disease 5C56.1 Whole blood 2.21E-01 4.63E-02 1.40E+00
Behcet's disease 4A62 Peripheral blood 9.00E-01 3.45E-02 2.23E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.19E-01 -2.15E-02 -2.96E-01
Bladder cancer 2C94 Bladder tissue 9.49E-01 2.51E-01 3.95E-01
Breast cancer 2C60-2C6Z Breast tissue 7.64E-20 -7.06E-01 -6.75E-01
Cardioembolic stroke 8B11.20 Whole blood 5.38E-01 -4.57E-03 -2.81E-02
Cervical cancer 2C77 Cervical tissue 8.53E-01 -2.35E-02 -1.20E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.29E-01 -3.14E-04 -3.13E-03
Chronic hepatitis C 1E51.1 Whole blood 8.34E-01 2.16E-04 1.25E-03
Chronic obstructive pulmonary disease CA22 Lung tissue 4.82E-01 1.47E-02 1.48E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.64E-01 3.28E-03 3.92E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.79E-01 -1.25E-03 -1.42E-02
Colon cancer 2B90 Colon tissue 4.85E-199 -3.99E+00 -5.55E+00
Coronary artery disease BA80-BA8Z Peripheral blood 4.93E-01 -8.72E-02 -3.65E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.16E-01 3.91E-02 2.79E-01
Endometriosis GA10 Endometrium tissue 4.00E-01 8.34E-02 2.37E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.83E-01 -1.72E-02 -3.40E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.55E-06 -1.65E-01 -1.25E+00
Gastric cancer 2B72 Gastric tissue 7.56E-04 1.55E-01 1.16E+00
Glioblastopma 2A00.00 Nervous tissue 3.20E-03 -4.06E-02 -2.81E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.58E-01 2.70E-02 2.41E-01
Head and neck cancer 2D42 Head and neck tissue 6.55E-01 -7.22E-03 -6.67E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.32E-01 -5.16E-02 -2.99E-01
Huntington's disease 8A01.10 Whole blood 1.78E-01 -6.03E-02 -7.63E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.26E-01 -1.17E-01 -1.06E+00
Immunodeficiency 4A00-4A20 Peripheral blood 9.23E-01 1.18E-03 1.29E-02
Influenza 1.00E+30 Whole blood 7.53E-03 1.89E-01 6.16E+00
Interstitial cystitis GC00.3 Bladder tissue 6.64E-01 -3.95E-02 -5.17E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.55E-01 -7.02E-02 -4.36E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.88E-01 3.77E-02 1.05E-01
Ischemic stroke 8B11 Peripheral blood 2.27E-01 4.99E-02 5.10E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.02E-01 3.29E-02 1.41E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.16E-01 1.92E-01 1.24E+00
Lateral sclerosis 8B60.4 Skin 5.01E-02 7.85E-02 1.38E+00
Liver cancer 2C12.0 Liver tissue 1.35E-10 9.20E-02 3.12E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.62E-01 4.81E-02 3.38E-01
Lung cancer 2C25 Lung tissue 1.15E-02 1.06E-02 8.95E-02
Lupus erythematosus 4A40 Whole blood 6.76E-05 4.31E-02 2.67E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.24E-01 3.14E-02 1.65E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.19E-02 4.14E-02 5.74E-01
Melanoma 2C30 Skin 2.05E-05 -1.15E+00 -1.20E+00
Multiple myeloma 2A83.1 Bone marrow 2.53E-02 -1.54E-01 -5.72E-01
Multiple myeloma 2A83.1 Peripheral blood 6.73E-02 6.66E-02 6.84E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.12E-01 5.95E-02 3.31E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.26E-01 -3.46E-02 -4.54E-01
Myelofibrosis 2A20.2 Whole blood 8.87E-01 -1.21E-03 -1.37E-02
Myocardial infarction BA41-BA50 Peripheral blood 8.38E-02 3.78E-02 8.92E-02
Myopathy 8C70.6 Muscle tissue 7.94E-01 4.06E-02 2.78E-01
Neonatal sepsis KA60 Whole blood 5.94E-03 4.08E-02 3.85E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.68E-02 -1.55E-01 -9.41E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 2.77E-01 -2.15E-02 -1.98E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.00E-01 5.81E-02 1.26E+00
Olive pollen allergy CA08.00 Peripheral blood 2.22E-02 1.33E-01 1.69E+00
Oral cancer 2B6E Oral tissue 1.07E-03 -1.23E-01 -7.44E-01
Osteoarthritis FA00-FA0Z Synovial tissue 7.38E-02 -1.59E-01 -1.06E+00
Osteoporosis FB83.1 Bone marrow 2.90E-02 2.13E-01 6.74E+00
Ovarian cancer 2C73 Ovarian tissue 5.56E-02 8.87E-02 3.86E-01
Pancreatic cancer 2C10 Pancreas 9.47E-01 -1.64E-02 -1.79E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 3.25E-02 5.03E-02 8.52E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.32E-01 -2.42E-03 -2.64E-02
Pituitary cancer 2D12 Pituitary tissue 6.03E-02 1.22E-01 8.36E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.40E-01 1.17E-02 8.21E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.26E-01 -2.09E-02 -3.00E-01
Polycythemia vera 2A20.4 Whole blood 1.13E-10 1.43E-01 1.77E+00
Pompe disease 5C51.3 Biceps muscle 6.36E-02 -1.12E-01 -8.57E-01
Preterm birth KA21.4Z Myometrium 2.68E-04 -7.43E-01 -3.61E+00
Prostate cancer 2C82 Prostate 4.96E-01 1.80E-01 2.41E-01
Psoriasis EA90 Skin 4.81E-10 -2.53E-01 -4.44E-01
Rectal cancer 2B92 Rectal colon tissue 8.32E-07 -2.58E+00 -4.63E+00
Renal cancer 2C90-2C91 Kidney 2.31E-02 -2.32E-01 -1.19E+00
Retinoblastoma 2D02.2 Uvea 1.08E-02 -1.01E-01 -2.56E+00
Rheumatoid arthritis FA20 Synovial tissue 2.68E-03 -3.45E-01 -2.27E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.82E-01 -1.27E-02 -1.23E-01
Schizophrenia 6A20 Prefrontal cortex 6.68E-01 -1.47E-02 -1.32E-01
Schizophrenia 6A20 Superior temporal cortex 3.25E-01 3.01E-03 5.39E-02
Scleroderma 4A42.Z Whole blood 3.60E-02 6.77E-02 6.50E-01
Seizure 8A60-8A6Z Whole blood 7.58E-01 2.02E-02 1.23E-01
Sensitive skin EK0Z Skin 1.61E-01 -3.04E-01 -1.35E+00
Sepsis with septic shock 1G41 Whole blood 2.21E-03 3.32E-02 2.26E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.78E-02 5.64E-02 4.62E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.53E-01 6.47E-02 3.81E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.90E-02 1.18E-01 1.79E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.46E-01 -3.39E-02 -5.57E-01
Skin cancer 2C30-2C3Z Skin 5.47E-17 -2.30E-01 -3.24E-01
Thrombocythemia 3B63 Whole blood 2.44E-02 1.04E-01 1.16E+00
Thrombocytopenia 3B64 Whole blood 2.23E-01 -5.69E-02 -4.38E-01
Thyroid cancer 2D10 Thyroid 2.33E-01 -3.25E-02 -8.10E-02
Tibial muscular dystrophy 8C75 Muscle tissue 7.31E-03 -1.16E-01 -9.63E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.90E-01 1.64E-01 1.22E+00
Type 2 diabetes 5A11 Liver tissue 2.90E-01 -8.83E-02 -9.01E-01
Ureter cancer 2C92 Urothelium 4.68E-02 -2.04E-01 -8.04E-01
Uterine cancer 2C78 Endometrium tissue 2.39E-05 -7.41E-02 -2.04E-01
Vitiligo ED63.0 Skin 9.21E-01 -2.15E-01 -2.55E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases