Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTO18LP)

DTP Name Sodium/potassium/calcium exchanger 3 (SLC24A3)
Gene Name SLC24A3
UniProt ID
Q9HC58 (NCKX3_HUMAN)
VARIDT ID
DTD0164
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms NCKX3; Na(+)/K(+)/Ca(2+)-exchange protein 3; SLC24A3; Solute carrier family 24 member 3
DTP Family Ca(2+):Cation Antiporter (CACA) Family ;
Tissue Specificity Abundant in the brain. Expressed at low levelsin the aorta, uterus and intestine.
Sequence
MRPSGDEDRARRRRRRRRRRDLLLSQLCFLASVALLLWSLSSLREQKELDLMDLVGEDRK
WMMARKLMQVNDTLTSEDAGLRNSKNCTEPALHEFPNDIFTNEDRRQGAVVLHVLCAIYM
FYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGV
GTIVGSAVFNILCIIGVCGLFAGQVVALSSWCLLRDSIYYTLSVIALIVFIYDEKVSWWE
SLVLVLMYLIYIVIMKYNACIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKK
ANFHRKASVIMVDELLSAYPHQLSFSEAGLRIMITSHFPPKTRLSMASRMLINERQRLIN
SRAYTNGESEVAIKIPIKHTVENGTGPSSAPDRGVNGTRRDDVVAEAGNETENENEDNEN
DEEEEEDEDDDEGPYTPFDTPSGKLETVKWAFTWPLSFVLYFTVPNCNKPRWEKWFMVTF
ASSTLWIAAFSYMMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDM
AVSNSIGSNVFDILIGLGLPWALQTLAVDYGSYIRLNSRGLIYSVGLLLASVFVTVFGVH
LNKWQLDKKLGCGCLLLYGVFLCFSIMTEFNVFTFVNLPMCGDH
Function This transporter transports Ca(2+) and K(+) in exchange for Na(+).
Endogenous Substrate(s) Ca2+; K+; Na+
TCDB ID
2.A.19.4.10
Gene ID
57419
Reactome Pathway
Sodium/Calcium exchangers (R-HSA-425561 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.00E-04 -4.78E-01 -8.00E-01
Adrenocortical carcinoma 2D11.Z Kidney 8.59E-01 -3.93E-01 -5.00E-01
Alopecia ED70 Skin from scalp 1.33E-04 2.60E-01 8.80E-01
Alzheimer's disease 8A20 Entorhinal cortex 3.46E-02 -2.88E-01 -2.88E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.16E-01 3.58E-02 7.82E-02
Aortic stenosis BB70 Calcified aortic valve 8.48E-01 -3.24E-01 -3.14E-01
Apnea 7A40 Hyperplastic tonsil 1.70E-01 -1.09E+00 -4.47E+00
Arthropathy FA00-FA5Z Peripheral blood 2.21E-02 4.61E-01 9.92E-01
Asthma CA23 Nasal and bronchial airway 8.54E-15 1.13E+00 1.17E+00
Atopic dermatitis EA80 Skin 3.48E-01 -3.27E-03 -1.61E-02
Autism 6A02 Whole blood 3.50E-01 9.52E-03 1.70E-02
Autoimmune uveitis 9A96 Peripheral monocyte 9.47E-01 -5.29E-03 -5.72E-02
Autosomal dominant monocytopenia 4B04 Whole blood 6.65E-01 -1.39E-01 -2.70E-01
Bacterial infection of gingival 1C1H Gingival tissue 4.03E-08 -2.67E-01 -7.11E-01
Batten disease 5C56.1 Whole blood 3.09E-01 4.04E-01 3.27E-01
Behcet's disease 4A62 Peripheral blood 9.68E-01 -1.72E-01 -5.22E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.48E-01 2.50E+00 1.45E+00
Bladder cancer 2C94 Bladder tissue 4.97E-06 -1.89E+00 -4.02E+00
Breast cancer 2C60-2C6Z Breast tissue 8.67E-15 -4.05E-01 -4.58E-01
Cardioembolic stroke 8B11.20 Whole blood 5.49E-01 2.67E-01 3.61E-01
Cervical cancer 2C77 Cervical tissue 7.65E-08 -1.41E+00 -1.98E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.21E-02 3.88E-01 5.06E-01
Chronic hepatitis C 1E51.1 Whole blood 6.33E-01 2.59E-02 1.82E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.94E-02 -2.34E-01 -6.97E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.16E-01 4.59E-02 1.52E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.77E-01 -1.07E-01 -3.66E-01
Colon cancer 2B90 Colon tissue 5.94E-04 1.29E-01 2.27E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.30E-02 8.58E-01 2.41E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.28E-01 -3.63E-01 -7.21E-01
Endometriosis GA10 Endometrium tissue 3.07E-01 -2.11E-01 -1.31E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.63E-01 1.80E-02 1.29E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.90E-02 1.46E+00 1.92E+00
Gastric cancer 2B72 Gastric tissue 8.66E-02 8.06E-01 1.34E+00
Glioblastopma 2A00.00 Nervous tissue 2.67E-05 4.38E-02 4.17E-02
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.54E-04 2.93E+00 2.05E+00
Head and neck cancer 2D42 Head and neck tissue 3.49E-02 4.13E-01 2.10E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.69E-02 -5.00E-01 -8.11E-01
Huntington's disease 8A01.10 Whole blood 4.42E-01 -1.43E-02 -3.63E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.86E-03 5.57E-01 2.14E+00
Immunodeficiency 4A00-4A20 Peripheral blood 9.82E-01 -8.06E-03 -9.05E-02
Influenza 1.00E+30 Whole blood 2.40E-02 2.36E-01 2.56E+00
Interstitial cystitis GC00.3 Bladder tissue 6.46E-01 7.85E-02 2.69E-01
Intracranial aneurysm 8B01.0 Intracranial artery 8.81E-01 -3.45E-02 -3.79E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.89E-01 -3.28E-02 -1.05E-01
Ischemic stroke 8B11 Peripheral blood 5.95E-01 5.97E-01 7.24E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.11E-05 4.99E-01 7.35E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.47E-01 -9.97E-02 -2.21E-01
Lateral sclerosis 8B60.4 Skin 7.43E-01 1.07E-01 3.36E-01
Liver cancer 2C12.0 Liver tissue 2.13E-02 -4.83E-01 -1.18E+00
Liver failure DB99.7-DB99.8 Liver tissue 4.08E-01 1.43E-01 2.96E-01
Lung cancer 2C25 Lung tissue 9.91E-36 -6.33E-01 -1.37E+00
Lupus erythematosus 4A40 Whole blood 2.44E-02 3.98E-01 3.82E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.08E-02 3.98E-01 6.21E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.65E-01 1.41E-01 8.18E-02
Melanoma 2C30 Skin 3.89E-02 -1.14E+00 -7.20E-01
Multiple myeloma 2A83.1 Bone marrow 9.93E-01 -2.30E-01 -4.62E-01
Multiple myeloma 2A83.1 Peripheral blood 3.57E-01 7.43E-02 3.62E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.96E-01 -2.56E-02 -1.48E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.14E-03 4.79E-01 7.46E-01
Myelofibrosis 2A20.2 Whole blood 7.04E-01 6.19E-02 2.23E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.53E-01 1.21E+00 8.67E-01
Myopathy 8C70.6 Muscle tissue 1.61E-02 -3.35E-01 -1.10E+00
Neonatal sepsis KA60 Whole blood 6.83E-04 1.97E-01 5.07E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.08E-03 9.01E-01 2.02E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.88E-02 -3.24E-02 -4.51E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.62E-01 4.54E-01 9.74E-01
Olive pollen allergy CA08.00 Peripheral blood 4.80E-01 1.31E-01 4.29E-01
Oral cancer 2B6E Oral tissue 2.69E-02 -7.65E-01 -6.96E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.09E-01 -4.22E-01 -2.91E-01
Osteoporosis FB83.1 Bone marrow 2.10E-01 -6.98E-01 -3.48E-01
Ovarian cancer 2C73 Ovarian tissue 3.13E-05 -1.51E+00 -2.91E+00
Pancreatic cancer 2C10 Pancreas 5.16E-03 4.38E-01 6.33E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.41E-01 2.45E-01 2.43E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.42E-02 1.81E-01 5.16E-01
Pituitary cancer 2D12 Pituitary tissue 2.27E-04 1.28E+00 2.60E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.26E-04 1.73E+00 3.38E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.37E-02 1.15E-01 4.92E-01
Polycythemia vera 2A20.4 Whole blood 1.60E-04 1.32E-01 4.72E-01
Pompe disease 5C51.3 Biceps muscle 1.79E-02 4.42E-01 1.47E+00
Preterm birth KA21.4Z Myometrium 8.44E-01 9.10E-02 1.80E-01
Prostate cancer 2C82 Prostate 5.40E-01 2.74E-01 3.07E-01
Psoriasis EA90 Skin 3.96E-20 6.22E-01 1.82E+00
Rectal cancer 2B92 Rectal colon tissue 7.50E-01 2.71E-03 1.05E-02
Renal cancer 2C90-2C91 Kidney 6.51E-01 5.86E-03 1.04E-02
Retinoblastoma 2D02.2 Uvea 6.93E-05 -2.38E+00 -3.85E+00
Rheumatoid arthritis FA20 Synovial tissue 6.47E-01 2.46E-01 1.55E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.65E-02 1.83E-02 1.08E-01
Schizophrenia 6A20 Prefrontal cortex 1.13E-01 -3.71E-01 -2.03E-01
Schizophrenia 6A20 Superior temporal cortex 3.73E-01 -2.35E-02 -8.38E-02
Scleroderma 4A42.Z Whole blood 4.23E-01 3.35E-01 4.34E-01
Seizure 8A60-8A6Z Whole blood 3.15E-02 -3.62E-01 -6.14E-01
Sensitive skin EK0Z Skin 7.55E-01 4.88E-02 4.19E-01
Sepsis with septic shock 1G41 Whole blood 3.89E-06 5.37E-02 1.44E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.46E-02 -5.10E-01 -1.00E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.58E-02 6.54E-01 1.91E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 7.99E-01 -3.08E-02 -8.37E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.36E-02 6.06E-01 2.61E+00
Skin cancer 2C30-2C3Z Skin 9.98E-81 -2.00E+00 -4.47E+00
Thrombocythemia 3B63 Whole blood 1.54E-02 4.05E-01 1.44E+00
Thrombocytopenia 3B64 Whole blood 6.85E-01 -2.57E-01 -2.32E-01
Thyroid cancer 2D10 Thyroid 3.43E-31 -1.26E+00 -2.82E+00
Tibial muscular dystrophy 8C75 Muscle tissue 4.32E-01 7.10E-02 9.95E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.66E-01 4.13E-01 2.24E+00
Type 2 diabetes 5A11 Liver tissue 1.71E-01 -4.93E-02 -4.68E-01
Ureter cancer 2C92 Urothelium 6.38E-02 -9.40E-02 -3.35E-01
Uterine cancer 2C78 Endometrium tissue 1.59E-60 -2.16E+00 -3.13E+00
Vitiligo ED63.0 Skin 5.43E-01 1.07E-01 8.95E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases