Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTOTME4)

DTP Name Anion exchange transporter (SLC26A7)
Gene Name SLC26A7
UniProt ID
Q8TE54 (S26A7_HUMAN)
VARIDT ID
DTD0235
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC26A7; SUT2; Solute carrier family 26 member 7
DTP Family Sulfate Permease (SULP) Family ;
Tissue Specificity Expressed in tonsillar high endothelial venuleendothelial cells (HEVEC), placenta and in testis, expressed in asubgroup of basal cells in the epididymal ducts.
Sequence
MTGAKRKKKSMLWSKMHTPQCEDIIQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQ
QVTQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGHHVATGTFALTSLISANAVERIVP
QNMQNLTTQSNTSVLGLSDFEMQRIHVAAAVSFLGGVIQVAMFVLQLGSATFVVTEPVIS
AMTTGAATHVVTSQVKYLLGMKMPYISGPLGFFYIYAYVFENIKSVRLEALLLSLLSIVV
LVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMENTYGLEVVGHIPQGIPSPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLSNIVSSFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTVSI
KNMKEMEFKVKTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNMIQKENACNQPLDDI
SKCEQNTLLNSLSNGNCNEEASQSCPNEKCYLILDCSGFTFFDYSGVSMLVEVYMDCKGR
SVDVLLAHCTASLIKAMTYYGNLDSEKPIFFESVSAAISHIHSNKNLSKLSDHSEV
Function
This transporter may play a role in the maintenance of the electrolyte and acid-base homeostasis in the kidney, by acting as a distal excretory segment-specific anion exchanger, and it plays a major role in gastric acid secretion. It acts as a sodium-independent DIDS-sensitive anion exchanger mediating bicarbonate, chloride, sulfate and oxalate transport.
Endogenous Substrate(s) Br-; Cl-; Hydroxide; I-
TCDB ID
2.A.53.2.6
Gene ID
115111
KEGG Pathway
Gastric acid secretion (hsa04971 )
Reactome Pathway
Multifunctional anion exchangers (R-HSA-427601 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
4 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
BICARBONATE DMT5E36 Discovery agent N.A. Investigative [1]
NITRATE DMVFB93 Discovery agent N.A. Investigative [2]
oxalate DM40SEU Discovery agent N.A. Investigative [2]
SULFATE DMW0ZBF Discovery agent N.A. Investigative [2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.82E-01 1.35E-02 1.47E-01
Adrenocortical carcinoma 2D11.Z Kidney 3.28E-02 3.61E-02 4.29E-01
Alopecia ED70 Skin from scalp 2.29E-02 7.55E-02 3.25E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.69E-01 1.55E-02 7.50E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 1.08E-01 -1.13E-01 -1.75E+00
Aortic stenosis BB70 Calcified aortic valve 8.03E-01 -5.95E-02 -2.30E-01
Apnea 7A40 Hyperplastic tonsil 8.84E-01 -6.50E-03 -8.82E-02
Arthropathy FA00-FA5Z Peripheral blood 2.11E-01 2.84E-02 3.31E-01
Asthma CA23 Nasal and bronchial airway 2.38E-02 -3.06E-02 -1.30E-01
Atopic dermatitis EA80 Skin 8.22E-01 -7.72E-02 -9.94E-02
Autism 6A02 Whole blood 8.09E-01 2.03E-02 2.01E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.27E-02 4.77E-01 2.92E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.52E-01 5.14E-02 4.64E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.95E-01 -4.10E-02 -3.86E-01
Batten disease 5C56.1 Whole blood 5.60E-01 1.95E-02 1.48E-01
Behcet's disease 4A62 Peripheral blood 3.91E-01 -4.93E-03 -6.43E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.08E-02 6.03E-02 6.78E-01
Bladder cancer 2C94 Bladder tissue 4.40E-01 -2.33E-01 -1.60E+00
Breast cancer 2C60-2C6Z Breast tissue 3.16E-11 -3.62E-01 -7.55E-01
Cardioembolic stroke 8B11.20 Whole blood 7.66E-02 7.32E-02 5.52E-01
Cervical cancer 2C77 Cervical tissue 5.23E-01 -3.09E-02 -4.21E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.47E-02 -6.42E-02 -5.84E-01
Chronic hepatitis C 1E51.1 Whole blood 9.72E-01 -8.01E-02 -5.15E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.14E-01 -5.53E-03 -2.55E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 8.42E-01 5.24E-02 3.85E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.37E-01 5.85E-02 4.63E-01
Colon cancer 2B90 Colon tissue 1.48E-10 -1.36E-01 -6.08E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.76E-01 -7.14E-02 -5.64E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.55E-02 -6.20E-02 -5.89E-01
Endometriosis GA10 Endometrium tissue 2.72E-03 -7.90E-01 -1.20E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.71E-01 1.92E-02 1.94E-01
Familial hypercholesterolemia 5C80.00 Whole blood 7.34E-01 2.56E-02 3.07E-01
Gastric cancer 2B72 Gastric tissue 3.31E-01 -7.65E-01 -1.07E+00
Glioblastopma 2A00.00 Nervous tissue 2.97E-66 2.91E-01 1.02E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.41E-01 4.85E-02 3.44E-01
Head and neck cancer 2D42 Head and neck tissue 9.49E-09 -1.33E-01 -5.58E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.84E-01 -2.27E-02 -1.80E-01
Huntington's disease 8A01.10 Whole blood 5.98E-01 2.75E-02 4.16E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.76E-01 7.05E-02 5.85E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.69E-02 -2.01E-01 -1.13E+00
Influenza 1.00E+30 Whole blood 8.35E-02 8.18E-02 2.23E+00
Interstitial cystitis GC00.3 Bladder tissue 5.05E-01 -1.55E-01 -1.51E+00
Intracranial aneurysm 8B01.0 Intracranial artery 7.53E-01 -1.43E-01 -4.85E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.97E-01 -3.23E-02 -1.07E-01
Ischemic stroke 8B11 Peripheral blood 3.11E-01 -9.49E-03 -7.45E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 8.47E-01 -4.87E-03 -1.86E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 2.73E-01 7.04E-02 3.85E-01
Lateral sclerosis 8B60.4 Skin 9.12E-01 4.34E-02 7.87E-01
Liver cancer 2C12.0 Liver tissue 7.40E-04 3.82E-02 2.43E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.40E-02 -1.85E-01 -6.43E-01
Lung cancer 2C25 Lung tissue 6.76E-03 3.56E-02 1.28E-01
Lupus erythematosus 4A40 Whole blood 5.43E-03 4.45E-02 2.57E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.61E-01 2.24E-02 1.05E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.07E-01 2.86E-03 2.85E-02
Melanoma 2C30 Skin 3.32E-03 -3.47E-01 -9.69E-01
Multiple myeloma 2A83.1 Bone marrow 1.09E-03 6.38E-02 9.90E-01
Multiple myeloma 2A83.1 Peripheral blood 1.93E-01 9.52E-02 7.05E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.35E-01 -2.47E-02 -8.37E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.10E-01 2.43E-03 2.86E-02
Myelofibrosis 2A20.2 Whole blood 1.57E-05 -8.08E-02 -1.04E+00
Myocardial infarction BA41-BA50 Peripheral blood 3.52E-01 2.07E-03 9.92E-03
Myopathy 8C70.6 Muscle tissue 8.86E-02 4.83E-02 3.29E-01
Neonatal sepsis KA60 Whole blood 9.91E-01 -1.51E-02 -1.01E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.34E-01 5.19E-01 1.06E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.94E-01 -7.89E-03 -1.20E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.96E-02 1.76E-01 1.35E+00
Olive pollen allergy CA08.00 Peripheral blood 9.05E-02 2.08E-01 1.28E+00
Oral cancer 2B6E Oral tissue 5.82E-04 4.16E-02 3.61E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.20E-01 -8.36E-01 -1.23E+00
Osteoporosis FB83.1 Bone marrow 1.28E-02 1.98E-01 4.66E+00
Ovarian cancer 2C73 Ovarian tissue 8.27E-06 6.66E-01 3.20E+00
Pancreatic cancer 2C10 Pancreas 1.22E-01 -1.29E-01 -2.11E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 1.44E-01 1.97E-02 2.53E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.63E-01 3.02E-02 3.50E-01
Pituitary cancer 2D12 Pituitary tissue 2.04E-02 -3.72E-01 -1.58E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.50E-01 -2.58E-01 -8.91E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.23E-02 5.77E-02 6.92E-01
Polycythemia vera 2A20.4 Whole blood 1.68E-01 -2.07E-02 -3.07E-01
Pompe disease 5C51.3 Biceps muscle 5.45E-01 -1.11E-02 -8.26E-02
Preterm birth KA21.4Z Myometrium 5.12E-01 7.00E-02 2.44E-01
Prostate cancer 2C82 Prostate 1.95E-01 7.83E-02 3.76E-01
Psoriasis EA90 Skin 5.80E-04 -1.03E-01 -4.39E-01
Rectal cancer 2B92 Rectal colon tissue 5.96E-02 -3.48E-01 -7.86E-01
Renal cancer 2C90-2C91 Kidney 6.29E-07 -1.19E+00 -3.64E+00
Retinoblastoma 2D02.2 Uvea 4.09E-03 2.23E-01 2.76E+00
Rheumatoid arthritis FA20 Synovial tissue 1.52E-04 -1.88E+00 -3.75E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.60E-01 -5.00E-02 -5.46E-01
Schizophrenia 6A20 Prefrontal cortex 4.90E-01 4.14E-03 2.45E-02
Schizophrenia 6A20 Superior temporal cortex 4.43E-02 2.96E-02 6.86E-01
Scleroderma 4A42.Z Whole blood 1.99E-04 1.13E-01 1.67E+00
Seizure 8A60-8A6Z Whole blood 7.89E-01 2.82E-02 4.18E-01
Sensitive skin EK0Z Skin 1.12E-01 -2.20E-01 -2.41E+00
Sepsis with septic shock 1G41 Whole blood 5.05E-01 -2.17E-02 -1.60E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.17E-01 1.24E-01 9.51E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.60E-01 2.59E-03 2.44E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 6.25E-02 6.55E-02 1.59E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.77E-01 1.34E-01 4.61E-01
Skin cancer 2C30-2C3Z Skin 3.65E-02 -7.86E-02 -2.66E-01
Thrombocythemia 3B63 Whole blood 1.23E-02 -1.23E-02 -1.60E-01
Thrombocytopenia 3B64 Whole blood 5.45E-01 8.03E-03 4.40E-02
Thyroid cancer 2D10 Thyroid 4.85E-42 -2.68E+00 -2.29E+00
Tibial muscular dystrophy 8C75 Muscle tissue 5.93E-01 -7.68E-03 -4.40E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.66E-01 -1.15E-01 -3.25E-01
Type 2 diabetes 5A11 Liver tissue 8.74E-02 -4.75E-02 -6.78E-01
Ureter cancer 2C92 Urothelium 4.76E-01 -6.75E-02 -2.04E-01
Uterine cancer 2C78 Endometrium tissue 1.98E-03 -4.75E-01 -7.00E-01
Vitiligo ED63.0 Skin 1.90E-01 1.51E-01 6.79E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Vasopressin induces expression of the Cl-/HCO3- exchanger SLC26A7 in kidney medullary collecting ducts of Brattleboro rats. Am J Physiol Renal Physiol. 2006 May;290(5):F1194-201.
2 The Transporter Classification Database (TCDB): recent advances. Nucleic Acids Res. 2016 Jan 4;44(D1):D372-9. (ID: 2.A.53.2.6)