Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTQNIG7)

DTP Name Sodium/glucose cotransporter 5 (SLC5A10)
Gene Name SLC5A10
UniProt ID
A0PJK1 (SC5AA_HUMAN)
VARIDT ID
DTD0419
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms Na(+)/glucose cotransporter 5; SGLT-5; SGLT5; SLC5A10; Solute carrier family 5 member 10
DTP Family Solute:Sodium Symporter (SSS) Family ;
Tissue Specificity Seems to be exclusively expressed in kidney.
Sequence
MAANSTSDLHTPGTQLSVADIIVITVYFALNVAVGIWSSCRASRNTVNGYFLAGRDMTWW
PIGASLFASSEGSGLFIGLAGSGAAGGLAVAGFEWNATYVLLALAWVFVPIYISSEIVTL
PEYIQKRYGGQRIRMYLSVLSLLLSVFTKISLDLYAGALFVHICLGWNFYLSTILTLGIT
ALYTIAGGLAAVIYTDALQTLIMVVGAVILTIKAFDQIGGYGQLEAAYAQAIPSRTIANT
TCHLPRTDAMHMFRDPHTGDLPWTGMTFGLTIMATWYWCTDQVIVQRSLSARDLNHAKAG
SILASYLKMLPMGLIIMPGMISRALFPDDVGCVVPSECLRACGAEVGCSNIAYPKLVMEL
MPIGLRGLMIAVMLAALMSSLTSIFNSSSTLFTMDIWRRLRPRSGERELLLVGRLVIVAL
IGVSVAWIPVLQDSNSGQLFIYMQSVTSSLAPPVTAVFVLGVFWRRANEQGAFWGLIAGL
VVGATRLVLEFLNPAPPCGEPDTRPAVLGSIHYLHFAVALFALSGAVVVAGSLLTPPPQS
VQIENLTWWTLAQDVPLGTKAGDGQTPQKHAFWARVCGFNAILLMCVNIFFYAYFA
Function This transporter mediataes the transport of mannose and fructose and, to a lesser extent, glucose, AMG, and galactose.
Endogenous Substrate(s) Na+
TCDB ID
2.A.21.3.15
Gene ID
125206
Reactome Pathway
Cellular hexose transport (R-HSA-189200 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
2-deoxyglucose DMIAHVU Solid tumour/cancer 2A00-2F9Z Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.68E-14 -5.63E-01 -1.12E+00
Adrenocortical carcinoma 2D11.Z Kidney 3.78E-01 5.01E-02 1.50E-01
Alopecia ED70 Skin from scalp 9.74E-12 -9.54E-01 -1.86E+00
Alzheimer's disease 8A20 Entorhinal cortex 2.35E-01 -1.38E-02 -9.47E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 3.63E-01 -1.10E-01 -8.32E-01
Aortic stenosis BB70 Calcified aortic valve 4.86E-01 2.22E-01 3.37E-01
Apnea 7A40 Hyperplastic tonsil 2.74E-03 -8.90E-01 -1.75E+00
Arthropathy FA00-FA5Z Peripheral blood 3.50E-01 2.62E-02 1.30E-01
Asthma CA23 Nasal and bronchial airway 4.38E-01 -5.34E-02 -1.27E-01
Atopic dermatitis EA80 Skin 4.45E-01 0.00E+00 0.00E+00
Autism 6A02 Whole blood 9.98E-01 -4.21E-02 -1.83E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.99E-01 -4.88E-02 -1.16E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.71E-01 1.33E-01 9.01E-01
Bacterial infection of gingival 1C1H Gingival tissue 7.35E-09 -3.36E-01 -9.30E-01
Batten disease 5C56.1 Whole blood 4.94E-01 -4.00E-02 -3.46E-01
Behcet's disease 4A62 Peripheral blood 1.64E-01 1.36E-01 6.35E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.33E-01 -2.53E-02 -1.48E-01
Bladder cancer 2C94 Bladder tissue 2.56E-03 3.82E-01 1.93E+00
Breast cancer 2C60-2C6Z Breast tissue 4.37E-01 -1.46E-02 -6.32E-02
Cardioembolic stroke 8B11.20 Whole blood 7.33E-01 -2.33E-02 -8.17E-02
Cervical cancer 2C77 Cervical tissue 1.49E-01 -1.28E-01 -5.03E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.10E-01 3.67E-03 1.29E-02
Chronic hepatitis C 1E51.1 Whole blood 6.51E-02 4.89E-02 2.78E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.61E-02 7.05E-02 2.73E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.91E-01 4.21E-02 1.99E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.98E-01 -2.58E-02 -2.14E-01
Colon cancer 2B90 Colon tissue 2.90E-03 -6.70E-02 -2.79E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.82E-01 1.73E-02 1.85E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.07E-01 1.04E-02 5.36E-02
Endometriosis GA10 Endometrium tissue 8.02E-01 -2.40E-03 -1.50E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.33E-01 -3.95E-02 -2.21E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.89E-02 -1.61E-01 -8.12E-01
Gastric cancer 2B72 Gastric tissue 7.15E-01 -6.93E-02 -4.20E-01
Glioblastopma 2A00.00 Nervous tissue 5.83E-08 1.06E-01 4.18E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.11E-06 -6.40E-01 -3.45E+00
Head and neck cancer 2D42 Head and neck tissue 2.52E-07 1.66E-01 6.68E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.68E-02 -7.70E-02 -5.69E-01
Huntington's disease 8A01.10 Whole blood 3.67E-01 -1.79E-02 -6.73E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.82E-02 -1.80E-01 -1.68E+00
Immunodeficiency 4A00-4A20 Peripheral blood 5.18E-01 -3.48E-02 -4.32E-01
Influenza 1.00E+30 Whole blood 3.15E-01 1.76E-01 1.87E+00
Interstitial cystitis GC00.3 Bladder tissue 1.73E-01 4.47E-02 1.71E+00
Intracranial aneurysm 8B01.0 Intracranial artery 5.45E-02 1.43E-01 9.53E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.73E-01 -2.59E-02 -1.10E-01
Ischemic stroke 8B11 Peripheral blood 4.29E-01 2.17E-02 1.24E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.36E-01 2.93E-04 9.34E-04
Lateral sclerosis 8B60.4 Cervical spinal cord 4.72E-01 8.63E-02 2.36E-01
Lateral sclerosis 8B60.4 Skin 1.27E-02 9.62E-02 1.07E+00
Liver cancer 2C12.0 Liver tissue 5.23E-10 -2.88E-01 -1.42E+00
Liver failure DB99.7-DB99.8 Liver tissue 8.41E-01 1.62E-02 1.06E-01
Lung cancer 2C25 Lung tissue 6.89E-02 -4.18E-02 -2.03E-01
Lupus erythematosus 4A40 Whole blood 1.21E-01 -2.08E-01 -3.02E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.51E-01 -2.16E-02 -6.41E-02
Major depressive disorder 6A70-6A7Z Hippocampus 8.21E-02 2.82E-02 1.69E-01
Melanoma 2C30 Skin 1.71E-01 5.76E-01 6.71E-01
Multiple myeloma 2A83.1 Bone marrow 1.10E-04 -7.94E-01 -2.90E+00
Multiple myeloma 2A83.1 Peripheral blood 1.30E-01 1.20E-01 5.48E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.70E-01 -8.69E-03 -3.64E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.30E-02 3.73E-02 1.57E-01
Myelofibrosis 2A20.2 Whole blood 2.58E-02 2.11E-01 1.65E+00
Myocardial infarction BA41-BA50 Peripheral blood 1.41E-01 1.90E-01 2.46E-01
Myopathy 8C70.6 Muscle tissue 1.16E-01 -6.16E-02 -4.31E-01
Neonatal sepsis KA60 Whole blood 8.77E-01 3.55E-02 1.22E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.25E-01 6.24E-04 1.38E-03
Non-alcoholic fatty liver disease DB92 Liver tissue 5.97E-01 -4.24E-02 -2.30E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.67E-01 4.56E-02 2.86E-01
Olive pollen allergy CA08.00 Peripheral blood 2.59E-02 1.89E-01 1.31E+00
Oral cancer 2B6E Oral tissue 1.01E-02 -1.75E-01 -3.08E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.32E-01 0.00E+00 0.00E+00
Osteoporosis FB83.1 Bone marrow 1.30E-01 1.91E-01 2.92E+00
Ovarian cancer 2C73 Ovarian tissue 7.86E-01 -7.18E-02 -3.49E-01
Pancreatic cancer 2C10 Pancreas 5.01E-02 -1.31E-01 -3.40E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 7.88E-01 -5.10E-02 -3.05E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.33E-01 -2.09E-02 -1.62E-01
Pituitary cancer 2D12 Pituitary tissue 3.20E-03 1.99E-01 7.76E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.27E-02 9.94E-02 3.21E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.40E-01 1.09E-02 1.02E-01
Polycythemia vera 2A20.4 Whole blood 3.02E-05 8.58E-02 6.86E-01
Pompe disease 5C51.3 Biceps muscle 8.56E-01 -1.55E-02 -8.93E-02
Preterm birth KA21.4Z Myometrium 6.20E-01 3.42E-02 2.11E-01
Prostate cancer 2C82 Prostate 9.63E-03 -5.88E-01 -6.42E-01
Psoriasis EA90 Skin 1.25E-01 9.03E-02 2.16E-01
Rectal cancer 2B92 Rectal colon tissue 1.73E-01 -1.53E-01 -4.68E-01
Renal cancer 2C90-2C91 Kidney 3.67E-01 -1.53E+00 -9.96E-01
Retinoblastoma 2D02.2 Uvea 1.16E-02 3.87E-01 2.82E+00
Rheumatoid arthritis FA20 Synovial tissue 5.95E-02 -4.60E-01 -1.16E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.28E-01 3.38E-02 2.41E-01
Schizophrenia 6A20 Prefrontal cortex 3.43E-01 1.23E-02 6.08E-02
Schizophrenia 6A20 Superior temporal cortex 8.60E-01 1.07E-02 8.01E-02
Scleroderma 4A42.Z Whole blood 4.85E-05 2.85E-01 2.16E+00
Seizure 8A60-8A6Z Whole blood 8.13E-01 -3.49E-02 -1.96E-01
Sensitive skin EK0Z Skin 2.52E-01 -1.28E-01 -5.41E-01
Sepsis with septic shock 1G41 Whole blood 1.11E-05 1.63E-01 4.79E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.11E-01 2.11E-01 5.08E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.58E-01 1.93E-01 9.12E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.71E-01 -1.29E-01 -1.87E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.29E-01 -2.32E-02 -1.40E-01
Skin cancer 2C30-2C3Z Skin 3.91E-05 -2.65E-01 -5.29E-01
Thrombocythemia 3B63 Whole blood 6.55E-03 1.66E-01 1.27E+00
Thrombocytopenia 3B64 Whole blood 1.70E-02 2.60E-01 1.52E+00
Thyroid cancer 2D10 Thyroid 3.05E-01 1.87E-02 9.72E-02
Tibial muscular dystrophy 8C75 Muscle tissue 7.30E-03 -2.10E-01 -1.18E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.26E-02 1.20E-01 1.39E+00
Type 2 diabetes 5A11 Liver tissue 2.62E-01 9.05E-03 5.13E-02
Ureter cancer 2C92 Urothelium 6.88E-01 -1.20E-02 -6.28E-02
Uterine cancer 2C78 Endometrium tissue 1.05E-01 -5.28E-02 -2.24E-01
Vitiligo ED63.0 Skin 6.99E-01 1.01E-02 4.73E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 The sodium/glucose cotransport family SLC5. Pflugers Arch. 2004 Feb;447(5):510-8.