Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTQPK6R)

DTP Name Sodium/hydrogen exchanger 7 (SLC9A7)
Gene Name SLC9A7
UniProt ID
Q96T83 (SL9A7_HUMAN)
VARIDT ID
DTD0491
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms MRX108; NHE-7; NHE7; Na(+)/H(+) exchanger 7; SLC9A7; Solute carrier family 9 member 7
DTP Family Monovalent Cation:Proton Antiporter-1 (CPA1) family ;
Tissue Specificity Ubiquitously expressed.
Sequence
MEPGDAARPGSGRATGAPPPRLLLLPLLLGWGLRVAAAASASSSGAAAEDSSAMEELATE
KEAEESHRQDSVSLLTFILLLTLTILTIWLFKHRRVRFLHETGLAMIYGLIVGVILRYGT
PATSGRDKSLSCTQEDRAFSTLLVNVSGKFFEYTLKGEISPGKINSVEQNDMLRKVTFDP
EVFFNILLPPIIFHAGYSLKKRHFFRNLGSILAYAFLGTAVSCFIIGNLMYGVVKLMKIM
GQLSDKFYYTDCLFFGAIISATDPVTVLAIFNELHADVDLYALLFGESVLNDAVAIVLSS
SIVAYQPAGLNTHAFDAAAFFKSVGIFLGIFSGSFTMGAVTGVNANVTKFTKLHCFPLLE
TALFFLMSWSTFLLAEACGFTGVVAVLFCGITQAHYTYNNLSVESRSRTKQLFEVLHFLA
ENFIFSYMGLALFTFQKHVFSPIFIIGAFVAIFLGRAAHIYPLSFFLNLGRRHKIGWNFQ
HMMMFSGLRGAMAFALAIRDTASYARQMMFTTTLLIVFFTVWIIGGGTTPMLSWLNIRVG
VEEPSEEDQNEHHWQYFRVGVDPDQDPPPNNDSFQVLQGDGPDSARGNRTKQESAWIFRL
WYSFDHNYLKPILTHSGPPLTTTLPAWCGLLARCLTSPQVYDNQEPLREEDSDFILTEGD
LTLTYGDSTVTANGSSSSHTASTSLEGSRRTKSSSEEVLERDLGMGDQKVSSRGTRLVFP
LEDNA
Function This transporter mediates proton neutral exchange of sodium (+) and potassium (+) across the intima. It may help to balance Golgi apparatus and cations in vivo.
Endogenous Substrate(s) Na+; K+; H+
TCDB ID
2.A.36.1.3
Gene ID
84679
KEGG Pathway
Cardiac muscle contraction (hsa04260 )
Reactome Pathway
Sodium/Proton exchangers (R-HSA-425986 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.90E-37 2.83E-01 1.53E+00
Adrenocortical carcinoma 2D11.Z Kidney 5.02E-01 1.70E-02 8.94E-02
Alopecia ED70 Skin from scalp 9.38E-01 5.12E-02 2.28E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.82E-06 -3.26E-01 -7.29E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.17E-01 -5.16E-02 -9.60E-02
Aortic stenosis BB70 Calcified aortic valve 6.40E-01 1.20E-01 2.61E-01
Apnea 7A40 Hyperplastic tonsil 9.60E-01 7.82E-03 9.23E-02
Arthropathy FA00-FA5Z Peripheral blood 3.98E-01 2.81E-02 2.23E-01
Asthma CA23 Nasal and bronchial airway 4.89E-02 1.98E-01 3.07E-01
Atopic dermatitis EA80 Skin 1.38E-03 8.77E-02 1.01E+00
Autism 6A02 Whole blood 1.43E-01 -1.03E-02 -6.60E-02
Autoimmune uveitis 9A96 Peripheral monocyte 2.15E-01 -1.67E-01 -1.17E+00
Autosomal dominant monocytopenia 4B04 Whole blood 6.35E-02 -5.38E-02 -6.04E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.74E-04 1.05E-01 6.76E-01
Batten disease 5C56.1 Whole blood 3.66E-01 -2.18E-02 -1.70E-01
Behcet's disease 4A62 Peripheral blood 4.45E-01 4.50E-02 1.74E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.18E-01 -6.82E-02 -3.79E-01
Bladder cancer 2C94 Bladder tissue 1.01E-02 3.79E-01 1.30E+00
Breast cancer 2C60-2C6Z Breast tissue 7.55E-42 2.27E-01 9.44E-01
Cardioembolic stroke 8B11.20 Whole blood 1.90E-02 -1.72E-01 -5.04E-01
Cervical cancer 2C77 Cervical tissue 3.28E-01 -2.62E-02 -1.16E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.16E-01 3.46E-02 1.79E-01
Chronic hepatitis C 1E51.1 Whole blood 8.45E-01 -7.80E-02 -6.35E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.92E-01 -1.84E-02 -1.28E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.09E-01 3.18E-02 2.25E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.56E-01 -1.76E-02 -1.66E-01
Colon cancer 2B90 Colon tissue 1.02E-18 1.45E-01 7.68E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.84E-01 6.75E-02 5.52E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.60E-01 3.23E-01 7.89E-01
Endometriosis GA10 Endometrium tissue 2.85E-01 3.39E-02 6.16E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.81E-01 -6.57E-02 -3.99E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.17E-01 -5.50E-02 -3.29E-01
Gastric cancer 2B72 Gastric tissue 8.49E-01 6.11E-02 1.56E-01
Glioblastopma 2A00.00 Nervous tissue 9.35E-41 -4.31E-01 -1.04E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.43E-01 1.28E-01 2.72E-01
Head and neck cancer 2D42 Head and neck tissue 4.43E-21 2.22E-01 1.44E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.52E-01 -1.46E-01 -3.70E-01
Huntington's disease 8A01.10 Whole blood 6.41E-01 -8.65E-02 -8.17E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.03E-01 1.08E-01 5.85E-01
Immunodeficiency 4A00-4A20 Peripheral blood 7.45E-02 6.88E-02 1.01E+00
Influenza 1.00E+30 Whole blood 1.66E-01 -1.07E-01 -1.79E+00
Interstitial cystitis GC00.3 Bladder tissue 1.67E-01 8.70E-02 9.77E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.67E-02 2.40E-01 9.92E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.63E-01 7.38E-03 3.68E-02
Ischemic stroke 8B11 Peripheral blood 4.11E-01 8.10E-02 4.82E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.09E-02 -6.89E-02 -2.62E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.87E-01 -1.19E-01 -5.79E-01
Lateral sclerosis 8B60.4 Skin 6.97E-01 -6.63E-02 -1.33E-01
Liver cancer 2C12.0 Liver tissue 3.20E-02 -7.73E-02 -2.95E-01
Liver failure DB99.7-DB99.8 Liver tissue 8.44E-01 -1.39E-02 -9.30E-02
Lung cancer 2C25 Lung tissue 2.19E-78 3.31E-01 1.97E+00
Lupus erythematosus 4A40 Whole blood 7.04E-01 1.27E-01 3.08E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.38E-01 -1.12E-01 -3.96E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.60E-01 4.56E-03 2.58E-02
Melanoma 2C30 Skin 6.07E-01 -1.66E-01 -3.96E-01
Multiple myeloma 2A83.1 Bone marrow 3.35E-01 -4.92E-02 -4.05E-01
Multiple myeloma 2A83.1 Peripheral blood 8.19E-01 7.82E-03 4.69E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.27E-01 1.78E-01 6.66E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.02E-01 -2.46E-02 -1.29E-01
Myelofibrosis 2A20.2 Whole blood 3.97E-02 9.31E-02 9.09E-01
Myocardial infarction BA41-BA50 Peripheral blood 9.97E-02 1.48E-01 3.09E-01
Myopathy 8C70.6 Muscle tissue 4.57E-01 3.33E-02 2.11E-01
Neonatal sepsis KA60 Whole blood 1.65E-05 -1.18E-01 -6.96E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.25E-01 -1.34E-01 -5.04E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 8.91E-01 4.71E-02 6.59E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.81E-01 7.33E-02 7.65E-01
Olive pollen allergy CA08.00 Peripheral blood 8.54E-01 8.45E-03 3.65E-02
Oral cancer 2B6E Oral tissue 1.28E-01 -1.18E-01 -5.53E-01
Osteoarthritis FA00-FA0Z Synovial tissue 5.84E-01 -1.86E-01 -1.01E+00
Osteoporosis FB83.1 Bone marrow 5.71E-01 2.00E-01 3.46E-01
Ovarian cancer 2C73 Ovarian tissue 1.64E-02 1.03E-01 9.32E-01
Pancreatic cancer 2C10 Pancreas 5.82E-01 -1.14E-02 -3.39E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 3.90E-01 -1.37E-01 -7.23E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.88E-01 6.52E-02 2.90E-01
Pituitary cancer 2D12 Pituitary tissue 6.31E-01 2.12E-01 6.92E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.72E-01 2.12E-01 7.76E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.87E-02 1.47E-01 1.05E+00
Polycythemia vera 2A20.4 Whole blood 4.46E-02 6.48E-02 4.99E-01
Pompe disease 5C51.3 Biceps muscle 2.47E-03 -6.13E-01 -2.30E+00
Preterm birth KA21.4Z Myometrium 7.83E-01 4.97E-02 4.49E-01
Prostate cancer 2C82 Prostate 1.64E-11 1.70E+00 3.05E+00
Psoriasis EA90 Skin 3.99E-08 1.99E-01 8.40E-01
Rectal cancer 2B92 Rectal colon tissue 8.08E-01 -7.15E-02 -5.54E-01
Renal cancer 2C90-2C91 Kidney 7.77E-02 1.42E-01 5.78E-01
Retinoblastoma 2D02.2 Uvea 3.32E-06 -2.80E-01 -2.85E+00
Rheumatoid arthritis FA20 Synovial tissue 4.80E-01 1.31E-01 4.74E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.01E-02 -5.52E-02 -2.21E-01
Schizophrenia 6A20 Prefrontal cortex 3.55E-02 -9.59E-02 -4.60E-01
Schizophrenia 6A20 Superior temporal cortex 6.16E-01 -6.32E-02 -3.59E-01
Scleroderma 4A42.Z Whole blood 1.13E-02 1.19E-01 7.93E-01
Seizure 8A60-8A6Z Whole blood 1.62E-01 -7.20E-02 -6.93E-01
Sensitive skin EK0Z Skin 3.71E-01 3.24E-02 3.12E-01
Sepsis with septic shock 1G41 Whole blood 3.99E-05 -1.01E-01 -5.71E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.50E-01 -1.07E-01 -3.01E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.28E-02 7.20E-02 4.88E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.21E-01 -2.11E-03 -2.65E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.63E-01 6.18E-02 4.58E-01
Skin cancer 2C30-2C3Z Skin 3.94E-12 1.05E-01 3.30E-01
Thrombocythemia 3B63 Whole blood 2.15E-01 2.31E-02 2.19E-01
Thrombocytopenia 3B64 Whole blood 8.97E-01 9.94E-02 2.87E-01
Thyroid cancer 2D10 Thyroid 1.26E-19 2.50E-01 1.19E+00
Tibial muscular dystrophy 8C75 Muscle tissue 6.46E-02 -9.98E-02 -3.56E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.23E-02 -3.92E-01 -1.41E+00
Type 2 diabetes 5A11 Liver tissue 9.01E-01 6.72E-02 6.12E-01
Ureter cancer 2C92 Urothelium 4.00E-01 1.44E-02 1.64E-01
Uterine cancer 2C78 Endometrium tissue 4.87E-27 2.43E-01 1.13E+00
Vitiligo ED63.0 Skin 6.65E-01 1.78E-01 4.44E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases