Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTQWF14)

DTP Name Sodium/potassium/calcium exchanger 4 (SLC24A4)
Gene Name SLC24A4
UniProt ID
Q8NFF2 (NCKX4_HUMAN)
VARIDT ID
DTD0165
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms AI2A5; NCKX4; Na(+)/K(+)/Ca(2+)-exchange protein 4; SHEP6; SLC24A4 NCKX4; Solute carrier family 24 member 4
DTP Family Ca(2+):Cation Antiporter (CACA) Family ;
Tissue Specificity Expressed abundantly in all regions of thebrain, aorta, lung and thymus. Expressed at lower levels in thestomach and intestine.
Sequence
MALRGTLRPLKVRRRREMLPQQVGFVCAVLALVCCASGLFGSLGHKTASASKRVLPDTWR
NRKLMAPVNGTQTAKNCTDPAIHEFPTDLFSNKERQHGAVLLHILGALYMFYALAIVCDD
FFVPSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIVGSAVFN
ILCIIGVCGLFAGQVVRLTWWAVCRDSVYYTISVIVLIVFIYDEQIVWWEGLVLIILYVF
YILIMKYNVKMQAFFTVKQKSIANGNPVNSELEAGNDFYDGSYDDPSVPLLGQVKEKPQY
GKNPVVMVDEIMSSSPPKFTFPEAGLRIMITNKFGPRTRLRMASRIIINERQRLINSANG
VSSKPLQNGRHENIENGNVPVENPEDPQQNQEQQPPPQPPPPEPEPVEADFLSPFSVPEA
RGDKVKWVFTWPLIFLLCVTIPNCSKPRWEKFFMVTFITATLWIAVFSYIMVWLVTIIGY
TLGIPDVIMGITFLAAGTSVPDCMASLIVARQGLGDMAVSNTIGSNVFDILVGLGVPWGL
QTMVVNYGSTVKINSRGLVYSVVLLLGSVALTVLGIHLNKWRLDRKLGVYVLVLYAIFLC
FSIMIEFNVFTFVNLPMCREDD
Function
This transporter transports 1 Ca(2+) and 1 K(+) in exchange for 4 Na(+) and Controls the rapid response termination and proper regulation of adaptation in olfactory sensory neurons (OSNs) which subsequently influences how odor information is encoded and perceived. It may play a role in calcium transport during amelogenesis.
Endogenous Substrate(s) Ca2+; K+; Na+
TCDB ID
2.A.19.4.5
Gene ID
123041
KEGG Pathway
Olfactory transduction (hsa04740 )
Reactome Pathway
Defective SLC24A4 causes hypomineralized amelogenesis imperfecta (AI) (R-HSA-5619055 )
Sodium/Calcium exchangers (R-HSA-425561 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.28E-10 -5.09E-01 -6.21E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.97E-01 -1.08E-01 -4.50E-01
Alopecia ED70 Skin from scalp 2.11E-02 -1.55E-02 -6.48E-02
Alzheimer's disease 8A20 Entorhinal cortex 3.70E-04 1.98E-01 3.92E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.07E-01 -9.66E-02 -9.89E-01
Aortic stenosis BB70 Calcified aortic valve 6.01E-01 7.49E-02 1.07E-01
Apnea 7A40 Hyperplastic tonsil 5.15E-01 1.14E-02 5.56E-02
Arthropathy FA00-FA5Z Peripheral blood 6.15E-01 3.26E-01 9.04E-01
Asthma CA23 Nasal and bronchial airway 3.85E-02 7.44E-02 3.05E-01
Atopic dermatitis EA80 Skin 8.72E-02 1.71E-02 1.28E-01
Autism 6A02 Whole blood 1.57E-01 1.42E-01 2.58E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.92E-02 1.09E+00 2.81E+00
Autosomal dominant monocytopenia 4B04 Whole blood 9.62E-01 2.37E-02 2.42E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.77E-02 6.62E-02 3.73E-01
Batten disease 5C56.1 Whole blood 2.62E-01 -4.09E-01 -1.08E+00
Behcet's disease 4A62 Peripheral blood 8.81E-01 2.70E-01 7.12E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.26E-01 1.27E-01 2.90E-01
Bladder cancer 2C94 Bladder tissue 1.67E-03 3.34E-01 1.99E+00
Breast cancer 2C60-2C6Z Breast tissue 1.29E-24 -2.30E-01 -8.88E-01
Cardioembolic stroke 8B11.20 Whole blood 2.11E-02 3.67E-01 5.84E-01
Cervical cancer 2C77 Cervical tissue 1.95E-01 -6.64E-02 -3.93E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.29E-01 -8.92E-02 -1.24E-01
Chronic hepatitis C 1E51.1 Whole blood 5.21E-01 -6.28E-01 -5.83E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.33E-01 7.05E-02 3.64E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.57E-01 -5.28E-02 -3.36E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.69E-01 -1.25E-02 -7.84E-02
Colon cancer 2B90 Colon tissue 7.13E-15 -1.60E-01 -7.52E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.13E-01 4.81E-01 7.42E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.51E-01 -6.82E-02 -2.84E-01
Endometriosis GA10 Endometrium tissue 8.72E-01 6.51E-02 2.79E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.70E-02 -4.52E-01 -8.47E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.20E-07 1.76E+00 1.70E+00
Gastric cancer 2B72 Gastric tissue 1.98E-01 -1.34E-01 -1.60E+00
Glioblastopma 2A00.00 Nervous tissue 7.79E-34 -7.78E-01 -1.09E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.53E-03 -4.03E-01 -6.46E-01
Head and neck cancer 2D42 Head and neck tissue 1.77E-01 4.69E-02 3.09E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.27E-01 -5.64E-02 -1.71E-01
Huntington's disease 8A01.10 Whole blood 7.07E-01 -9.25E-02 -9.60E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.32E-05 -5.96E-01 -6.19E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.91E-01 4.06E-02 5.48E-01
Influenza 1.00E+30 Whole blood 9.19E-02 -2.93E-01 -1.34E+00
Interstitial cystitis GC00.3 Bladder tissue 3.46E-03 3.26E-01 4.15E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.87E-01 5.97E-02 2.24E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.20E-02 1.06E-01 3.97E-01
Ischemic stroke 8B11 Peripheral blood 6.20E-01 7.33E-02 1.63E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.54E-03 2.61E-01 4.68E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 1.63E-02 4.13E-01 8.64E-01
Lateral sclerosis 8B60.4 Skin 7.53E-01 3.36E-03 3.60E-02
Liver cancer 2C12.0 Liver tissue 2.20E-06 -1.79E-01 -7.38E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.08E-04 4.27E-01 2.45E+00
Lung cancer 2C25 Lung tissue 2.84E-29 -3.19E-01 -1.26E+00
Lupus erythematosus 4A40 Whole blood 1.25E-07 6.85E-01 6.18E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.36E-02 1.36E-01 2.85E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.26E-01 -1.32E-02 -3.05E-02
Melanoma 2C30 Skin 2.86E-07 2.37E-01 5.73E-01
Multiple myeloma 2A83.1 Bone marrow 5.41E-04 -3.90E-01 -2.25E+00
Multiple myeloma 2A83.1 Peripheral blood 1.80E-01 1.08E-01 5.39E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 8.99E-02 3.78E-01 1.19E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.47E-08 1.82E-01 1.06E+00
Myelofibrosis 2A20.2 Whole blood 5.13E-01 1.79E-01 4.25E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.75E-05 1.78E+00 1.16E+00
Myopathy 8C70.6 Muscle tissue 9.25E-01 -2.24E-02 -1.16E-01
Neonatal sepsis KA60 Whole blood 2.58E-15 9.97E-01 1.43E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.11E-08 -2.34E+00 -4.60E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 9.94E-01 -5.75E-02 -3.19E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.59E-01 2.96E-01 8.49E-01
Olive pollen allergy CA08.00 Peripheral blood 6.58E-01 1.28E-01 4.51E-01
Oral cancer 2B6E Oral tissue 3.61E-03 -1.79E-01 -7.61E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.68E-01 -2.76E-01 -5.16E-01
Osteoporosis FB83.1 Bone marrow 4.44E-01 1.75E-01 1.11E+00
Ovarian cancer 2C73 Ovarian tissue 6.50E-03 -3.07E-01 -1.48E+00
Pancreatic cancer 2C10 Pancreas 7.30E-04 -2.97E-01 -1.23E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 5.58E-01 3.89E-01 6.59E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.63E-03 9.51E-01 1.19E+00
Pituitary cancer 2D12 Pituitary tissue 1.08E-02 -7.17E-01 -1.10E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.64E-02 -6.50E-01 -9.25E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 1.44E-01 -9.23E-02 -5.87E-01
Polycythemia vera 2A20.4 Whole blood 6.68E-02 5.52E-02 1.27E-01
Pompe disease 5C51.3 Biceps muscle 4.34E-02 -6.03E-02 -5.98E-01
Preterm birth KA21.4Z Myometrium 6.47E-02 -5.61E-01 -1.36E+00
Prostate cancer 2C82 Prostate 8.49E-01 1.25E-02 3.29E-02
Psoriasis EA90 Skin 4.35E-03 4.64E-02 1.93E-01
Rectal cancer 2B92 Rectal colon tissue 5.17E-03 -2.49E-01 -2.06E+00
Renal cancer 2C90-2C91 Kidney 7.09E-02 9.57E-02 4.01E-01
Retinoblastoma 2D02.2 Uvea 5.63E-08 -2.26E+00 -4.84E+00
Rheumatoid arthritis FA20 Synovial tissue 7.64E-02 -2.39E-01 -4.35E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.83E-01 2.24E-02 1.94E-01
Schizophrenia 6A20 Prefrontal cortex 1.78E-01 1.01E-01 1.22E-01
Schizophrenia 6A20 Superior temporal cortex 7.83E-01 5.06E-02 4.69E-01
Scleroderma 4A42.Z Whole blood 2.61E-05 7.27E-01 2.25E+00
Seizure 8A60-8A6Z Whole blood 2.72E-01 -1.22E-01 -1.33E-01
Sensitive skin EK0Z Skin 3.54E-01 -1.27E-01 -8.49E-01
Sepsis with septic shock 1G41 Whole blood 1.16E-25 7.43E-01 1.23E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.82E-01 8.54E-02 8.80E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 7.56E-03 -6.08E-01 -1.49E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 7.22E-01 -4.88E-02 -1.23E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.11E-02 1.11E-01 9.83E-01
Skin cancer 2C30-2C3Z Skin 3.59E-20 2.18E-01 7.14E-01
Thrombocythemia 3B63 Whole blood 6.69E-01 -2.96E-02 -7.06E-02
Thrombocytopenia 3B64 Whole blood 3.92E-01 2.58E-02 8.94E-02
Thyroid cancer 2D10 Thyroid 3.07E-01 -1.37E-02 -6.47E-02
Tibial muscular dystrophy 8C75 Muscle tissue 9.86E-01 -1.28E-02 -6.26E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.66E-02 -6.94E-01 -3.65E+00
Type 2 diabetes 5A11 Liver tissue 9.44E-01 -2.05E-02 -1.01E-01
Ureter cancer 2C92 Urothelium 2.39E-01 -7.33E-02 -7.20E-01
Uterine cancer 2C78 Endometrium tissue 5.27E-01 3.91E-02 1.02E-01
Vitiligo ED63.0 Skin 6.54E-01 -1.15E-01 -6.28E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases