Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTS4MKQ)

DTP Name Glucose transporter type 6 (SLC2A6)
Gene Name SLC2A6
UniProt ID
Q9UGQ3 (GTR6_HUMAN)
VARIDT ID
DTD0264
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms GLUT-6; GLUT6; HSA011372; SLC2A6; Solute carrier family 2, facilitated glucose transporter member 6
DTP Family Major Facilitator Superfamily (MFS)
Sugar Porter (SP) Family
Tissue Specificity Highly expressed in brain, spleen andperipheral blood leukocytes.
Sequence
MQEPLLGAEGPDYDTFPEKPPPSPGDRARVGTLQNKRVFLATFAAVLGNFSFGYALVYTS
PVIPALERSLDPDLHLTKSQASWFGSVFTLGAAAGGLSAMILNDLLGRKLSIMFSAVPSA
AGYALMAGAHGLWMLLLGRTLTGFAGGLTAACIPVYVSEIAPPGVRGALGATPQLMAVFG
SLSLYALGLLLPWRWLAVAGEAPVLIMILLLSFMPNSPRFLLSRGRDEEALRALAWLRGT
DVDVHWEFEQIQDNVRRQSSRVSWAEARAPHVCRPITVALLMRLLQQLTGITPILVYLQS
IFDSTAVLLPPKDDAAIVGAVRLLSVLIAALTMDLAGRKVLLFVSAAIMFAANLTLGLYI
HFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLLATMLFIMGYAVGWGPITWLL
MSEVLPLRARGVASGLCVLASWLTAFVLTKSFLPVVSTFGLQVPFFFFAAICLVSLVFTG
CCVPETKGRSLEQIESFFRTGRRSFLR
Function This transporter facilitates glucose transport and binds cytochalasin B with low affinity.
Endogenous Substrate(s) Glucose
TCDB ID
2.A.1.1.88
Gene ID
11182
Reactome Pathway
Cellular hexose transport (R-HSA-189200 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
2-deoxyglucose DMIAHVU Solid tumour/cancer 2A00-2F9Z Approved [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.27E-01 -6.46E-02 -1.04E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.46E-02 2.81E-01 5.79E-01
Alopecia ED70 Skin from scalp 2.07E-02 1.26E-01 3.23E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.77E-03 -1.36E-01 -3.99E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.67E-02 -3.24E-01 -6.03E-01
Aortic stenosis BB70 Calcified aortic valve 1.96E-01 9.79E-02 1.97E-01
Apnea 7A40 Hyperplastic tonsil 2.90E-01 3.10E-01 1.03E+00
Arthropathy FA00-FA5Z Peripheral blood 1.62E-01 -1.46E-01 -7.58E-01
Asthma CA23 Nasal and bronchial airway 2.92E-02 -6.60E-02 -1.18E-01
Atopic dermatitis EA80 Skin 1.88E-10 5.76E-01 2.55E+00
Autism 6A02 Whole blood 7.75E-01 -1.20E-01 -3.59E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.23E-01 2.05E-01 2.54E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.86E-02 4.04E-01 9.78E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.70E-13 5.22E-01 1.24E+00
Batten disease 5C56.1 Whole blood 2.98E-01 -2.76E-01 -8.36E-01
Behcet's disease 4A62 Peripheral blood 9.52E-01 -1.26E-02 -5.02E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.82E-01 3.78E-02 2.36E-01
Bladder cancer 2C94 Bladder tissue 3.28E-02 1.25E-02 4.87E-02
Breast cancer 2C60-2C6Z Breast tissue 1.25E-64 4.69E-01 1.21E+00
Cardioembolic stroke 8B11.20 Whole blood 1.45E-02 1.93E-01 6.12E-01
Cervical cancer 2C77 Cervical tissue 8.06E-04 1.66E-01 6.59E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.09E-01 7.35E-02 1.05E-01
Chronic hepatitis C 1E51.1 Whole blood 3.91E-01 -8.60E-02 -1.33E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.80E-02 -1.51E-01 -3.03E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.68E-01 -1.34E-02 -3.77E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.47E-01 4.85E-03 2.17E-02
Colon cancer 2B90 Colon tissue 7.06E-02 2.24E-03 5.35E-03
Coronary artery disease BA80-BA8Z Peripheral blood 6.24E-01 6.09E-01 4.43E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.37E-01 -7.73E-02 -1.67E-01
Endometriosis GA10 Endometrium tissue 6.39E-01 2.01E-01 1.71E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.06E-01 -1.16E-01 -3.20E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.64E-11 2.09E+00 2.62E+00
Gastric cancer 2B72 Gastric tissue 2.55E-01 1.43E-01 2.63E-01
Glioblastopma 2A00.00 Nervous tissue 3.31E-170 -1.03E+00 -2.35E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.84E-04 1.72E+00 1.86E+00
Head and neck cancer 2D42 Head and neck tissue 7.55E-16 6.42E-01 1.28E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.15E-01 4.26E-02 1.03E-01
Huntington's disease 8A01.10 Whole blood 2.44E-01 3.55E-01 7.06E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.39E-01 2.89E-01 1.16E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.45E-01 -1.13E-02 -8.31E-02
Influenza 1.00E+30 Whole blood 9.90E-03 -8.49E-01 -3.07E+00
Interstitial cystitis GC00.3 Bladder tissue 3.65E-04 5.46E-01 2.87E+00
Intracranial aneurysm 8B01.0 Intracranial artery 5.50E-05 9.70E-01 2.14E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.64E-01 -1.33E-02 -3.04E-02
Ischemic stroke 8B11 Peripheral blood 7.60E-01 1.14E-01 1.61E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.24E-03 -2.88E-01 -5.73E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.19E-01 9.23E-01 9.22E-01
Lateral sclerosis 8B60.4 Skin 8.98E-01 -3.98E-02 -2.09E-01
Liver cancer 2C12.0 Liver tissue 8.11E-06 3.45E-01 7.93E-01
Liver failure DB99.7-DB99.8 Liver tissue 7.95E-05 1.16E+00 3.36E+00
Lung cancer 2C25 Lung tissue 1.73E-09 -2.24E-01 -4.39E-01
Lupus erythematosus 4A40 Whole blood 7.24E-01 1.88E-02 3.46E-02
Major depressive disorder 6A70-6A7Z Whole blood 7.32E-01 -2.93E-02 -6.20E-02
Major depressive disorder 6A70-6A7Z Hippocampus 2.06E-01 3.54E-02 2.12E-01
Melanoma 2C30 Skin 8.86E-01 -7.91E-02 -9.41E-02
Multiple myeloma 2A83.1 Bone marrow 9.62E-01 -2.89E-02 -1.61E-01
Multiple myeloma 2A83.1 Peripheral blood 4.99E-01 3.73E-02 9.87E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.53E-01 3.42E-02 9.61E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.15E-04 2.19E-01 7.19E-01
Myelofibrosis 2A20.2 Whole blood 8.67E-02 -2.21E-01 -6.37E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.59E-02 1.13E-01 2.21E-01
Myopathy 8C70.6 Muscle tissue 5.71E-01 2.65E-02 1.94E-01
Neonatal sepsis KA60 Whole blood 7.16E-02 -4.94E-02 -9.40E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.51E-01 -4.11E-01 -8.77E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 8.71E-01 6.69E-02 5.07E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.26E-01 -1.19E-01 -3.91E-01
Olive pollen allergy CA08.00 Peripheral blood 7.60E-01 -2.87E-02 -8.47E-02
Oral cancer 2B6E Oral tissue 2.53E-01 1.06E-01 2.07E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.61E-01 -2.45E-02 -3.58E-02
Osteoporosis FB83.1 Bone marrow 5.11E-01 -1.65E-02 -2.75E-02
Ovarian cancer 2C73 Ovarian tissue 6.20E-04 6.12E-01 1.63E+00
Pancreatic cancer 2C10 Pancreas 4.93E-01 2.50E-01 3.18E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.05E-03 -3.39E-01 -9.13E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.71E-01 1.56E-01 3.42E-01
Pituitary cancer 2D12 Pituitary tissue 2.49E-09 8.79E-01 3.20E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.30E-05 7.97E-01 2.50E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.53E-01 -1.19E-01 -4.90E-01
Polycythemia vera 2A20.4 Whole blood 2.52E-02 -9.30E-02 -2.63E-01
Pompe disease 5C51.3 Biceps muscle 5.25E-01 3.65E-02 1.62E-01
Preterm birth KA21.4Z Myometrium 5.91E-01 1.02E-01 1.71E-01
Prostate cancer 2C82 Prostate 1.21E-01 7.44E-01 6.99E-01
Psoriasis EA90 Skin 2.40E-13 1.98E-01 5.36E-01
Rectal cancer 2B92 Rectal colon tissue 6.24E-02 1.87E-01 8.52E-01
Renal cancer 2C90-2C91 Kidney 1.98E-03 2.94E-01 1.04E+00
Retinoblastoma 2D02.2 Uvea 3.61E-02 -7.32E-01 -1.18E+00
Rheumatoid arthritis FA20 Synovial tissue 1.43E-04 6.36E-01 2.02E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.56E-01 8.43E-02 3.98E-01
Schizophrenia 6A20 Prefrontal cortex 3.05E-01 -1.34E-03 -2.59E-03
Schizophrenia 6A20 Superior temporal cortex 3.26E-01 -3.79E-02 -3.04E-01
Scleroderma 4A42.Z Whole blood 1.15E-05 4.62E-01 2.49E+00
Seizure 8A60-8A6Z Whole blood 6.31E-01 -2.71E-01 -7.80E-01
Sensitive skin EK0Z Skin 3.67E-01 1.08E-01 5.73E-01
Sepsis with septic shock 1G41 Whole blood 5.35E-02 -5.07E-02 -9.37E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.28E-01 -2.89E-01 -7.76E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.71E-01 -3.99E-01 -1.48E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 9.88E-01 1.52E-01 3.67E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.00E-01 -7.38E-01 -1.04E+00
Skin cancer 2C30-2C3Z Skin 7.59E-30 7.41E-01 1.41E+00
Thrombocythemia 3B63 Whole blood 3.29E-01 -4.74E-02 -1.33E-01
Thrombocytopenia 3B64 Whole blood 5.65E-01 1.31E-01 1.28E-01
Thyroid cancer 2D10 Thyroid 9.40E-07 3.53E-01 5.11E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.78E-03 -2.83E-01 -1.24E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.95E-01 -3.34E-01 -5.02E+00
Type 2 diabetes 5A11 Liver tissue 5.88E-02 -2.18E-01 -1.34E+00
Ureter cancer 2C92 Urothelium 4.15E-01 2.28E-02 9.14E-02
Uterine cancer 2C78 Endometrium tissue 3.47E-06 3.29E-01 5.38E-01
Vitiligo ED63.0 Skin 3.20E-01 1.78E-01 8.34E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Functional Properties and Genomics of Glucose Transporters. Curr Genomics. 2007 Apr; 8(2): 113128.