Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTSF91X)

DTP Name Choline transporter-like protein 2 (SLC44A2)
Gene Name SLC44A2
UniProt ID
Q8IWA5 (CTL2_HUMAN)
VARIDT ID
DTD0364
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms CTL2; PP1292; SLC44A2; Solute carrier family 44 member 2
DTP Family Choline Transporter-Like (CTl) Family ;
Tissue Specificity Present in supporting cells of the inner ear(at protein level). Only isoform 3 is expressed in inner earvestibular tissue.
Sequence
MGDERPHYYGKHGTPQKYDPTFKGPIYNRGCTDIICCVFLLLAIVGYVAVGIIAWTHGDP
RKVIYPTDSRGEFCGQKGTKNENKPYLFYFNIVKCASPLVLLEFQCPTPQICVEKCPDRY
LTYLNARSSRDFEYYKQFCVPGFKNNKGVAEVLQDGDCPAVLIPSKPLARRCFPAIHAYK
GVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTVSWYWIIIGLV
IAMAMSLLFIILLRFLAGIMVWVMIIMVILVLGYGIFHCYMEYSRLRGEAGSDVSLVDLG
FQTDFRVYLHLRQTWLAFMIILSILEVIIILLLIFLRKRILIAIALIKEASRAVGYVMCS
LLYPLVTFFLLCLCIAYWASTAVFLSTSNEAVYKIFDDSPCPFTAKTCNPETFPSSNESR
QCPNARCQFAFYGGESGYHRALLGLQIFNAFMFFWLANFVLALGQVTLAGAFASYYWALR
KPDDLPAFPLFSAFGRALRYHTGSLAFGALILAIVQIIRVILEYLDQRLKAAENKFAKCL
MTCLKCCFWCLEKFIKFLNRNAYIMIAIYGTNFCTSARNAFFLLMRNIIRVAVLDKVTDF
LFLLGKLLIVGSVGILAFFFFTHRIRIVQDTAPPLNYYWVPILTVIVGSYLIAHGFFSVY
GMCVDTLFLCFLEDLERNDGSAERPYFMSSTLKKLLNKTNKKAAES
Function This isoform 1 of this transporter mediates choline transport.
Endogenous Substrate(s) Choline
TCDB ID
2.A.92.1.4
Gene ID
57153
KEGG Pathway
Choline metabolism in cancer (hsa05231 )
Reactome Pathway
Transport of bile salts and organic acids, metal ions and amine compounds (R-HSA-425366 )
Neutrophil degranulation (R-HSA-6798695 )
Synthesis of PC (R-HSA-1483191 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
CHOLINE DM5D9YK Insomnia 7A00-7A0Z Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.19E-62 -1.06E+00 -2.19E+00
Adrenocortical carcinoma 2D11.Z Kidney 1.29E-04 2.48E-01 7.45E-01
Alopecia ED70 Skin from scalp 8.78E-04 -1.57E-01 -8.47E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.70E-03 1.09E-01 2.60E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.45E-01 9.12E-03 3.49E-02
Aortic stenosis BB70 Calcified aortic valve 6.73E-01 5.15E-02 5.51E-02
Apnea 7A40 Hyperplastic tonsil 2.21E-01 2.96E-01 1.21E+00
Arthropathy FA00-FA5Z Peripheral blood 4.75E-02 2.01E-01 6.49E-01
Asthma CA23 Nasal and bronchial airway 1.39E-01 1.75E-02 3.00E-02
Atopic dermatitis EA80 Skin 9.43E-01 2.84E-03 1.85E-02
Autism 6A02 Whole blood 5.36E-01 1.30E-01 3.33E-01
Autoimmune uveitis 9A96 Peripheral monocyte 7.83E-01 1.74E-01 1.90E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.43E-03 -1.64E+00 -2.29E+00
Bacterial infection of gingival 1C1H Gingival tissue 7.53E-02 -1.08E-01 -3.30E-01
Batten disease 5C56.1 Whole blood 3.81E-01 -1.19E-01 -4.39E-01
Behcet's disease 4A62 Peripheral blood 4.65E-01 -2.48E-01 -7.08E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.46E-02 6.50E-02 2.85E-01
Bladder cancer 2C94 Bladder tissue 2.87E-01 -1.82E-01 -4.10E-01
Breast cancer 2C60-2C6Z Breast tissue 2.66E-25 3.20E-01 8.06E-01
Cardioembolic stroke 8B11.20 Whole blood 2.73E-01 -1.00E-01 -5.53E-01
Cervical cancer 2C77 Cervical tissue 4.02E-04 -3.28E-01 -8.62E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.91E-01 4.36E-01 3.84E-01
Chronic hepatitis C 1E51.1 Whole blood 7.09E-02 -1.62E-01 -1.24E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 2.52E-02 -1.34E-01 -3.78E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.86E-04 -2.76E-01 -6.71E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.30E-01 -4.08E-02 -1.69E-01
Colon cancer 2B90 Colon tissue 1.23E-50 -6.29E-01 -1.76E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.89E-01 -2.24E-02 -9.85E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 3.29E-01 3.39E-02 8.82E-02
Endometriosis GA10 Endometrium tissue 4.10E-01 2.33E-01 7.65E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.12E-01 2.11E-02 9.01E-02
Familial hypercholesterolemia 5C80.00 Whole blood 1.53E-04 -6.03E-01 -1.62E+00
Gastric cancer 2B72 Gastric tissue 2.36E-01 -7.87E-01 -1.25E+00
Glioblastopma 2A00.00 Nervous tissue 2.00E-20 3.66E-01 6.81E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.37E-02 -3.78E-01 -5.78E-01
Head and neck cancer 2D42 Head and neck tissue 1.17E-29 -7.01E-01 -1.88E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.86E-01 9.80E-02 1.98E-01
Huntington's disease 8A01.10 Whole blood 4.36E-01 9.86E-02 6.36E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.12E-01 1.72E-01 6.82E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.29E-01 -8.20E-03 -5.12E-02
Influenza 1.00E+30 Whole blood 6.76E-05 1.05E+00 8.62E+00
Interstitial cystitis GC00.3 Bladder tissue 7.60E-03 -1.05E+00 -2.62E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.75E-02 -4.30E-01 -1.01E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.71E-03 -2.60E-01 -6.69E-01
Ischemic stroke 8B11 Peripheral blood 8.39E-01 3.01E-02 8.14E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 5.50E-01 -4.54E-02 -6.50E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 2.07E-01 -2.01E-02 -8.76E-02
Lateral sclerosis 8B60.4 Skin 5.98E-01 3.10E-01 5.68E-01
Liver cancer 2C12.0 Liver tissue 3.03E-01 5.92E-03 2.04E-02
Liver failure DB99.7-DB99.8 Liver tissue 1.19E-04 1.35E+00 4.93E+00
Lung cancer 2C25 Lung tissue 5.16E-60 -7.43E-01 -1.65E+00
Lupus erythematosus 4A40 Whole blood 7.75E-01 5.84E-03 1.33E-02
Major depressive disorder 6A70-6A7Z Whole blood 5.52E-01 9.59E-02 2.27E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.46E-01 1.15E-03 5.08E-03
Melanoma 2C30 Skin 4.13E-03 -4.58E-01 -6.74E-01
Multiple myeloma 2A83.1 Bone marrow 9.70E-02 -3.17E-01 -1.13E+00
Multiple myeloma 2A83.1 Peripheral blood 5.45E-01 4.84E-01 5.04E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.50E-01 1.48E-01 2.77E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.75E-04 -5.78E-01 -7.42E-01
Myelofibrosis 2A20.2 Whole blood 8.80E-05 -6.25E-01 -2.63E+00
Myocardial infarction BA41-BA50 Peripheral blood 7.90E-01 3.05E-02 4.89E-02
Myopathy 8C70.6 Muscle tissue 8.74E-01 -6.18E-02 -2.13E-01
Neonatal sepsis KA60 Whole blood 5.49E-01 -3.94E-02 -9.04E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.92E-06 -1.34E+00 -3.13E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.97E-01 -9.93E-02 -8.21E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.64E-01 -4.06E-03 -1.19E-02
Olive pollen allergy CA08.00 Peripheral blood 8.73E-01 -8.32E-02 -1.93E-01
Oral cancer 2B6E Oral tissue 9.25E-07 -6.00E-01 -1.15E+00
Osteoarthritis FA00-FA0Z Synovial tissue 6.57E-01 1.67E-02 1.49E-02
Osteoporosis FB83.1 Bone marrow 4.31E-01 3.89E-01 1.16E+00
Ovarian cancer 2C73 Ovarian tissue 1.23E-05 1.44E+00 2.97E+00
Pancreatic cancer 2C10 Pancreas 4.61E-04 6.85E-01 1.30E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 3.06E-01 -7.34E-03 -1.64E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.68E-01 1.00E-02 6.53E-02
Pituitary cancer 2D12 Pituitary tissue 2.05E-01 1.23E-01 3.09E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.16E-01 -1.26E-01 -3.24E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.74E-03 1.73E-01 1.05E+00
Polycythemia vera 2A20.4 Whole blood 2.46E-03 -1.73E-01 -7.12E-01
Pompe disease 5C51.3 Biceps muscle 2.10E-02 2.51E-01 9.91E-01
Preterm birth KA21.4Z Myometrium 6.39E-01 3.86E-02 1.14E-01
Prostate cancer 2C82 Prostate 5.75E-01 -3.94E-02 -1.02E-01
Psoriasis EA90 Skin 6.46E-07 1.67E-01 5.01E-01
Rectal cancer 2B92 Rectal colon tissue 1.29E-03 -3.51E-01 -1.96E+00
Renal cancer 2C90-2C91 Kidney 4.04E-06 -6.31E-01 -2.02E+00
Retinoblastoma 2D02.2 Uvea 2.92E-03 5.25E-01 1.87E+00
Rheumatoid arthritis FA20 Synovial tissue 1.25E-02 1.03E+00 1.57E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.98E-01 -1.11E-02 -4.93E-02
Schizophrenia 6A20 Prefrontal cortex 3.32E-02 1.84E-01 2.38E-01
Schizophrenia 6A20 Superior temporal cortex 8.55E-01 1.40E-01 3.88E-01
Scleroderma 4A42.Z Whole blood 6.98E-02 -3.30E-01 -1.15E+00
Seizure 8A60-8A6Z Whole blood 9.49E-01 5.67E-02 2.15E-01
Sensitive skin EK0Z Skin 8.17E-01 2.14E-02 1.24E-01
Sepsis with septic shock 1G41 Whole blood 5.95E-07 2.39E-01 5.51E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 2.98E-02 -4.21E-01 -1.93E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.36E-04 5.76E-01 1.51E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 7.84E-01 7.89E-04 1.14E-03
Sjogren's syndrome 4A43.2 Salivary gland tissue 5.12E-01 6.31E-03 1.64E-01
Skin cancer 2C30-2C3Z Skin 3.28E-39 -6.79E-01 -2.27E+00
Thrombocythemia 3B63 Whole blood 3.99E-02 -2.09E-01 -8.69E-01
Thrombocytopenia 3B64 Whole blood 3.53E-01 3.34E-01 4.70E-01
Thyroid cancer 2D10 Thyroid 4.57E-01 7.20E-02 2.47E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.46E-01 1.69E-02 2.84E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.11E-02 6.16E-01 2.13E+00
Type 2 diabetes 5A11 Liver tissue 7.20E-01 -4.87E-02 -1.77E-01
Ureter cancer 2C92 Urothelium 8.98E-01 -4.68E-02 -3.19E-01
Uterine cancer 2C78 Endometrium tissue 3.80E-07 -3.07E-01 -5.88E-01
Vitiligo ED63.0 Skin 3.66E-01 -7.00E-02 -2.62E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 The choline transporter-like family SLC44: properties and roles in human diseases. Mol Aspects Med. 2013 Apr-Jun;34(2-3):646-54.