Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTTBSQG)

DTP Name Y+L amino acid transporter 2 (SLC7A6)
Gene Name SLC7A6
UniProt ID
Q92536 (YLAT2_HUMAN)
VARIDT ID
DTD0473
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms Cationic amino acid transporter, y+ system; KIAA0245; LAT-2; SLC7A6; Solute carrier family 7 member 6; Y+LAT2; y(+)L-type amino acid transporter 2; y+LAT-2
DTP Family Amino Acid-Polyamine-Organocation (APC) Family
L-type Amino Acid Transporter (LAT) Family
Sequence
MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMIG
SGIFVSPKGVLVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFG
GFIAFIRLWVSLLVVEPTGQAIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFV
NCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLAL
YSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVLS
SDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIH
IERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPR
PLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFI
RNVLAAITRGTQQLCFCVLTELDVAEEKKDERKTD
Function
This transporter involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. And it acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Requires coexpression with SLC3A2/4F2hc to mediate the uptake of arginine, leucine and glutamine.
Endogenous Substrate(s) Thyroid hormones; Thyroid hormone derivatives
TCDB ID
2.A.3.8.23
Gene ID
9057
Reactome Pathway
Amino acid transport across the plasma membrane (R-HSA-352230 )
Basigin interactions (R-HSA-210991 )
BioCyc Pathway
MetaCyc:ENSG00000103064-MON

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.88E-21 5.56E-01 1.03E+00
Adrenocortical carcinoma 2D11.Z Kidney 2.26E-05 4.94E-01 1.11E+00
Alopecia ED70 Skin from scalp 1.87E-10 3.02E-01 1.49E+00
Alzheimer's disease 8A20 Entorhinal cortex 6.37E-04 -1.54E-01 -4.59E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.09E-02 3.38E-01 9.97E-01
Aortic stenosis BB70 Calcified aortic valve 3.42E-02 2.87E-01 8.32E-01
Apnea 7A40 Hyperplastic tonsil 4.70E-01 1.33E-01 6.23E-01
Arthropathy FA00-FA5Z Peripheral blood 1.35E-01 -9.51E-02 -2.30E-01
Asthma CA23 Nasal and bronchial airway 6.46E-01 3.66E-02 5.31E-02
Atopic dermatitis EA80 Skin 8.84E-05 -4.93E-01 -1.31E+00
Autism 6A02 Whole blood 8.77E-01 4.09E-02 8.11E-02
Autoimmune uveitis 9A96 Peripheral monocyte 3.30E-01 1.69E-01 4.90E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.74E-02 -5.30E-01 -1.47E+00
Bacterial infection of gingival 1C1H Gingival tissue 2.56E-13 5.14E-01 1.35E+00
Batten disease 5C56.1 Whole blood 3.41E-01 1.80E-01 5.49E-01
Behcet's disease 4A62 Peripheral blood 6.42E-01 -6.86E-02 -2.25E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.23E-01 2.39E-02 1.01E-01
Bladder cancer 2C94 Bladder tissue 1.76E-01 3.36E-01 6.50E-01
Breast cancer 2C60-2C6Z Breast tissue 1.19E-08 5.15E-01 5.61E-01
Cardioembolic stroke 8B11.20 Whole blood 1.09E-04 -4.15E-01 -1.43E+00
Cervical cancer 2C77 Cervical tissue 4.70E-02 1.28E-01 3.26E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.71E-01 3.41E-02 3.34E-02
Chronic hepatitis C 1E51.1 Whole blood 8.65E-01 1.60E-01 4.99E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.38E-01 -3.40E-02 -9.29E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.80E-03 -2.32E-01 -4.79E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.64E-01 -4.86E-01 -1.93E+00
Colon cancer 2B90 Colon tissue 2.13E-38 8.24E-01 1.52E+00
Coronary artery disease BA80-BA8Z Peripheral blood 8.99E-01 4.54E-01 4.37E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.71E-01 -1.43E-01 -3.57E-01
Endometriosis GA10 Endometrium tissue 5.09E-01 -8.35E-02 -8.58E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.44E-01 -2.34E-01 -8.56E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.19E-01 -2.65E-01 -6.24E-01
Gastric cancer 2B72 Gastric tissue 1.07E-01 6.88E-01 1.93E+00
Glioblastopma 2A00.00 Nervous tissue 4.38E-01 -1.13E-01 -2.07E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.99E-03 5.78E-01 8.88E-01
Head and neck cancer 2D42 Head and neck tissue 8.54E-01 -1.68E-02 -2.06E-02
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.28E-01 -2.67E-02 -1.34E-01
Huntington's disease 8A01.10 Whole blood 2.13E-01 3.50E-01 5.48E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.70E-01 -3.84E-01 -1.08E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.29E-03 -3.61E-01 -1.52E+00
Influenza 1.00E+30 Whole blood 3.13E-02 -9.69E-01 -3.42E+00
Interstitial cystitis GC00.3 Bladder tissue 1.82E-05 1.09E+00 4.86E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.48E-04 7.97E-01 1.73E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.79E-01 -1.34E-02 -5.12E-02
Ischemic stroke 8B11 Peripheral blood 5.88E-01 1.88E-02 4.33E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 4.03E-01 -3.16E-02 -5.76E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 7.97E-01 -4.35E-01 -5.59E-01
Lateral sclerosis 8B60.4 Skin 7.89E-01 6.71E-02 1.35E-01
Liver cancer 2C12.0 Liver tissue 1.10E-38 7.43E-01 3.23E+00
Liver failure DB99.7-DB99.8 Liver tissue 8.45E-07 1.14E+00 4.19E+00
Lung cancer 2C25 Lung tissue 7.47E-08 -1.55E-01 -3.87E-01
Lupus erythematosus 4A40 Whole blood 1.03E-01 2.83E-01 2.93E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.20E-01 -4.44E-02 -1.39E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.75E-01 2.67E-02 1.23E-01
Melanoma 2C30 Skin 7.09E-01 1.52E-01 2.72E-01
Multiple myeloma 2A83.1 Bone marrow 2.34E-04 3.41E-01 2.02E+00
Multiple myeloma 2A83.1 Peripheral blood 3.80E-01 -1.22E-01 -5.28E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.65E-01 -4.73E-02 -1.50E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.65E-02 -9.98E-02 -2.12E-01
Myelofibrosis 2A20.2 Whole blood 1.38E-04 -1.01E+00 -3.88E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.42E-02 -6.57E-01 -6.41E-01
Myopathy 8C70.6 Muscle tissue 1.25E-01 4.02E-01 5.88E-01
Neonatal sepsis KA60 Whole blood 2.70E-03 -3.44E-01 -4.61E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.20E-02 3.54E-01 9.25E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 9.14E-01 -2.52E-02 -4.00E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.43E-01 -2.07E-01 -2.03E-01
Olive pollen allergy CA08.00 Peripheral blood 4.60E-02 -8.79E-01 -1.61E+00
Oral cancer 2B6E Oral tissue 1.61E-09 9.81E-01 1.72E+00
Osteoarthritis FA00-FA0Z Synovial tissue 8.83E-01 -2.95E-01 -5.39E-01
Osteoporosis FB83.1 Bone marrow 9.34E-02 -6.91E-01 -1.75E+00
Ovarian cancer 2C73 Ovarian tissue 4.61E-02 3.86E-01 7.66E-01
Pancreatic cancer 2C10 Pancreas 1.00E+00 1.34E-01 1.43E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 9.73E-02 1.10E-01 5.53E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.47E-05 -4.99E-01 -2.02E+00
Pituitary cancer 2D12 Pituitary tissue 8.98E-03 -4.03E-01 -8.17E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.18E-03 -3.76E-01 -1.12E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.26E-01 1.50E-01 3.98E-01
Polycythemia vera 2A20.4 Whole blood 1.69E-36 -9.30E-01 -3.92E+00
Pompe disease 5C51.3 Biceps muscle 6.83E-03 8.71E-01 1.55E+00
Preterm birth KA21.4Z Myometrium 1.65E-01 -1.56E-01 -5.75E-01
Prostate cancer 2C82 Prostate 1.26E-02 1.50E+00 1.33E+00
Psoriasis EA90 Skin 1.10E-03 8.68E-02 1.67E-01
Rectal cancer 2B92 Rectal colon tissue 1.81E-09 1.61E+00 8.03E+00
Renal cancer 2C90-2C91 Kidney 2.10E-02 2.10E-01 5.19E-01
Retinoblastoma 2D02.2 Uvea 1.68E-07 1.38E+00 3.70E+00
Rheumatoid arthritis FA20 Synovial tissue 5.78E-03 6.45E-01 1.58E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.07E-01 -2.26E-02 -1.08E-01
Schizophrenia 6A20 Prefrontal cortex 3.33E-01 -7.14E-03 -7.08E-03
Schizophrenia 6A20 Superior temporal cortex 9.32E-01 -2.52E-02 -1.95E-01
Scleroderma 4A42.Z Whole blood 3.88E-02 2.72E-01 9.79E-01
Seizure 8A60-8A6Z Whole blood 4.21E-01 -2.34E-02 -3.64E-02
Sensitive skin EK0Z Skin 3.17E-01 1.20E-01 6.50E-01
Sepsis with septic shock 1G41 Whole blood 1.36E-36 -7.10E-01 -1.25E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.96E-01 -4.44E-01 -5.41E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.28E-02 -5.89E-01 -1.01E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 8.56E-01 6.91E-02 8.48E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.98E-01 -6.99E-02 -2.80E-01
Skin cancer 2C30-2C3Z Skin 2.40E-29 7.05E-01 1.24E+00
Thrombocythemia 3B63 Whole blood 3.62E-13 -7.77E-01 -3.22E+00
Thrombocytopenia 3B64 Whole blood 1.92E-01 -3.96E-01 -8.06E-01
Thyroid cancer 2D10 Thyroid 2.88E-08 -3.91E-01 -6.15E-01
Tibial muscular dystrophy 8C75 Muscle tissue 8.72E-03 -6.06E-01 -7.73E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.33E-01 -2.38E-01 -5.80E-01
Type 2 diabetes 5A11 Liver tissue 9.16E-01 -6.61E-02 -4.75E-01
Ureter cancer 2C92 Urothelium 3.73E-01 -1.13E-01 -4.99E-01
Uterine cancer 2C78 Endometrium tissue 1.17E-01 6.74E-02 1.61E-01
Vitiligo ED63.0 Skin 5.55E-02 1.59E-01 1.02E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases