General Information of Drug Transporter (DTP) (ID: DTU58HL)

DTP Name Glucose-6-phosphate exchanger SLC37A2 (SLC37A2)
Gene Name SLC37A2
UniProt ID
Q8TED4 (G6PT3_HUMAN)
VARIDT ID
DTD0323
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC37A2; Solute carrier family 37 member 2; pp11662
DTP Family Major Facilitator Superfamily (MFS)
Organophosphate:Pi Antiporter (OPA) Family
Tissue Specificity Detected in intestine and pancreas. Lowerexpression is also detected in liver and kidney.
Sequence
MRSSLAPGVWFFRAFSRDSWFRGLILLLTFLIYACYHMSRKPISIVKSRLHQNCSEQIKP
INDTHSLNDTMWCSWAPFDKDNYKELLGGVDNAFLIAYAIGMFISGVFGERLPLRYYLSA
GMLLSGLFTSLFGLGYFWNIHELWYFVVIQVCNGLVQTTGWPSVVTCVGNWFGKGKRGFI
MGIWNSHTSVGNILGSLIAGIWVNGQWGLSFIVPGIITAVMGVITFLFLIEHPEDVDCAP
PQHHGEPAENQDNPEDPGNSPCSIRESGLETVAKCSKGPCEEPAAISFFGALRIPGVVEF
SLCLLFAKLVSYTFLYWLPLYIANVAHFSAKEAGDLSTLFDVGGIIGGIVAGLVSDYTNG
RATTCCVMLILAAPMMFLYNYIGQDGIASSIVMLIICGGLVNGPYALITTAVSADLGTHK
SLKGNAKALSTVTAIIDGTGSIGAALGPLLAGLISPTGWNNVFYMLISADVLACLLLCRL
VYKEILAWKVSLSRGSGYKEI
Function This transporter may mediates the transport of cytoplasmic glucose-6-phosphate into the lumen of the endoplasmic reticulum and translocate inorganic phosphate into the opposite direction.
Endogenous Substrate(s) Glycerol-3-phosphate
TCDB ID
2.A.1.4.8
Gene ID
219855
Reactome Pathway
Gluconeogenesis (R-HSA-70263 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.35E-03 4.11E-02 1.81E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.81E-06 -1.28E+00 -2.62E+00
Alopecia ED70 Skin from scalp 4.37E-01 1.61E-01 3.31E-01
Alzheimer's disease 8A20 Entorhinal cortex 5.73E-03 9.17E-02 5.13E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.88E-02 1.57E-01 4.50E-01
Aortic stenosis BB70 Calcified aortic valve 1.75E-01 3.80E-01 8.11E-01
Apnea 7A40 Hyperplastic tonsil 4.06E-01 -2.25E-01 -6.88E-01
Arthropathy FA00-FA5Z Peripheral blood 7.66E-01 6.69E-04 3.16E-03
Asthma CA23 Nasal and bronchial airway 7.53E-06 3.08E-01 4.19E-01
Atopic dermatitis EA80 Skin 9.63E-06 -3.88E-01 -2.43E+00
Autism 6A02 Whole blood 1.50E-01 8.58E-02 3.10E-01
Autoimmune uveitis 9A96 Peripheral monocyte 9.07E-01 -1.32E-02 -5.66E-02
Autosomal dominant monocytopenia 4B04 Whole blood 6.67E-01 1.03E-01 6.05E-01
Bacterial infection of gingival 1C1H Gingival tissue 5.55E-02 -3.21E-02 -7.93E-02
Batten disease 5C56.1 Whole blood 4.73E-01 1.36E-01 3.19E-01
Behcet's disease 4A62 Peripheral blood 9.50E-01 3.07E-02 8.93E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.22E-01 2.99E-02 1.53E-01
Bladder cancer 2C94 Bladder tissue 6.06E-01 -2.04E-01 -3.15E-01
Breast cancer 2C60-2C6Z Breast tissue 1.67E-01 5.23E-03 1.11E-02
Cardioembolic stroke 8B11.20 Whole blood 9.47E-02 -8.40E-03 -2.28E-02
Cervical cancer 2C77 Cervical tissue 1.70E-02 -3.11E-01 -6.03E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.50E-02 2.46E-01 1.04E+00
Chronic hepatitis C 1E51.1 Whole blood 1.88E-01 5.93E-02 2.40E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 7.70E-01 8.54E-04 2.59E-03
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.49E-06 3.80E-01 1.04E+00
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.47E-01 -1.44E-02 -9.11E-02
Colon cancer 2B90 Colon tissue 6.22E-13 -4.49E-01 -4.41E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.13E-01 1.32E-01 3.58E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.07E-01 3.61E-02 3.44E-01
Endometriosis GA10 Endometrium tissue 5.85E-01 9.22E-02 1.79E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.26E-01 -4.18E-02 -1.66E-01
Familial hypercholesterolemia 5C80.00 Whole blood 6.99E-04 5.42E-01 1.74E+00
Gastric cancer 2B72 Gastric tissue 8.53E-02 6.75E-02 6.01E-01
Glioblastopma 2A00.00 Nervous tissue 6.71E-16 -2.38E-01 -7.32E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.66E-01 -2.65E-01 -2.15E-01
Head and neck cancer 2D42 Head and neck tissue 2.70E-06 3.89E-01 7.40E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.66E-01 -2.28E-01 -9.95E-01
Huntington's disease 8A01.10 Whole blood 8.06E-01 0.00E+00 0.00E+00
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.16E-02 3.23E-01 8.89E-01
Immunodeficiency 4A00-4A20 Peripheral blood 3.71E-01 -1.46E-05 -1.76E-04
Influenza 1.00E+30 Whole blood 4.23E-01 -3.58E-01 -1.04E+00
Interstitial cystitis GC00.3 Bladder tissue 2.23E-02 -9.55E-01 -1.23E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.89E-02 6.60E-01 2.07E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.21E-01 1.52E-02 2.04E-02
Ischemic stroke 8B11 Peripheral blood 7.03E-02 -1.26E-01 -3.18E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.59E-02 -1.92E-01 -4.75E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.10E-02 -1.50E-01 -6.10E-01
Lateral sclerosis 8B60.4 Skin 7.43E-01 -3.32E-02 -2.04E-01
Liver cancer 2C12.0 Liver tissue 1.98E-02 -1.32E-01 -4.15E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.14E-04 7.44E-01 2.27E+00
Lung cancer 2C25 Lung tissue 2.84E-05 -1.74E-01 -4.27E-01
Lupus erythematosus 4A40 Whole blood 2.31E-01 7.34E-02 1.65E-01
Major depressive disorder 6A70-6A7Z Whole blood 2.92E-02 1.11E-01 2.97E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.76E-01 6.53E-02 3.39E-01
Melanoma 2C30 Skin 4.28E-01 -2.94E-01 -2.58E-01
Multiple myeloma 2A83.1 Bone marrow 1.31E-03 -3.61E-01 -1.38E+00
Multiple myeloma 2A83.1 Peripheral blood 4.52E-01 6.13E-02 3.65E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.86E-02 3.36E-01 1.91E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.18E-02 1.47E-01 3.67E-01
Myelofibrosis 2A20.2 Whole blood 9.01E-01 1.01E-02 4.17E-02
Myocardial infarction BA41-BA50 Peripheral blood 1.13E-04 3.68E-01 1.01E+00
Myopathy 8C70.6 Muscle tissue 7.37E-01 -1.07E-01 -7.58E-01
Neonatal sepsis KA60 Whole blood 3.26E-04 2.31E-01 5.37E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.18E-04 -6.64E-01 -2.03E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.57E-01 -8.66E-02 -3.22E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 4.67E-01 1.45E-01 1.50E+00
Olive pollen allergy CA08.00 Peripheral blood 3.61E-02 5.65E-01 1.67E+00
Oral cancer 2B6E Oral tissue 2.42E-03 -3.46E-01 -6.70E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.24E-01 -2.78E-01 -4.59E-01
Osteoporosis FB83.1 Bone marrow 4.35E-01 6.45E-02 2.90E-01
Ovarian cancer 2C73 Ovarian tissue 1.22E-01 3.44E-02 1.25E-01
Pancreatic cancer 2C10 Pancreas 3.17E-01 6.48E-02 1.43E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.43E-01 -6.19E-02 -2.42E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.67E-02 2.23E-01 5.82E-01
Pituitary cancer 2D12 Pituitary tissue 3.66E-03 3.72E-01 1.32E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.38E-02 2.19E-01 6.64E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.10E-01 -7.61E-02 -4.93E-01
Polycythemia vera 2A20.4 Whole blood 3.51E-02 6.63E-02 2.62E-01
Pompe disease 5C51.3 Biceps muscle 2.16E-01 9.55E-02 7.19E-01
Preterm birth KA21.4Z Myometrium 5.66E-01 -8.22E-02 -1.29E+00
Prostate cancer 2C82 Prostate 7.73E-01 -2.19E-01 -4.08E-01
Psoriasis EA90 Skin 9.38E-27 9.58E-01 1.77E+00
Rectal cancer 2B92 Rectal colon tissue 1.14E-01 -1.15E+00 -6.00E-01
Renal cancer 2C90-2C91 Kidney 5.44E-01 -1.36E-01 -2.87E-01
Retinoblastoma 2D02.2 Uvea 9.63E-01 -1.76E-01 -8.64E-01
Rheumatoid arthritis FA20 Synovial tissue 4.23E-02 -1.70E-01 -4.00E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.51E-01 -2.71E-03 -1.05E-02
Schizophrenia 6A20 Prefrontal cortex 2.58E-02 1.57E-01 3.03E-01
Schizophrenia 6A20 Superior temporal cortex 8.89E-01 3.48E-03 2.45E-02
Scleroderma 4A42.Z Whole blood 6.79E-01 -1.10E-01 -4.48E-01
Seizure 8A60-8A6Z Whole blood 9.95E-03 -1.98E-01 -5.32E-01
Sensitive skin EK0Z Skin 6.60E-01 6.95E-02 1.38E-01
Sepsis with septic shock 1G41 Whole blood 2.21E-03 -5.39E-03 -1.18E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.02E-01 -4.99E-02 -2.62E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.67E-01 -7.76E-02 -1.89E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.96E-01 2.24E-02 1.82E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.54E-01 1.49E-01 5.59E-01
Skin cancer 2C30-2C3Z Skin 4.29E-07 -3.67E-01 -6.08E-01
Thrombocythemia 3B63 Whole blood 8.36E-01 2.79E-02 1.16E-01
Thrombocytopenia 3B64 Whole blood 4.97E-01 4.69E-01 1.08E+00
Thyroid cancer 2D10 Thyroid 9.78E-15 3.48E-01 8.87E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.79E-01 5.92E-02 1.59E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 4.90E-02 1.10E-01 1.35E+00
Type 2 diabetes 5A11 Liver tissue 7.02E-01 -4.75E-02 -2.67E-01
Ureter cancer 2C92 Urothelium 8.88E-02 6.75E-02 2.75E-01
Uterine cancer 2C78 Endometrium tissue 5.17E-01 -2.32E-02 -3.84E-02
Vitiligo ED63.0 Skin 8.49E-01 -7.91E-02 -1.79E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases