Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTU8NCX)

DTP Name Choline transporter-like protein 5 (SLC44A5)
Gene Name SLC44A5
UniProt ID
Q8NCS7 (CTL5_HUMAN)
VARIDT ID
DTD0367
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms CTL5; SLC44A5; Solute carrier family 44 member 5
DTP Family Choline Transporter-Like (CTl) Family ;
Sequence
MNDTEKPADTPSEEEDFGDPRTYDPDFKGPVANRSCTDVLCCMIFLLCIIGYIVLGLVAW
VHGDPRRAAYPTDSQGHFCGQKGTPNENKTILFYFNLLRCTSPSVLLNLQCPTTQICVSK
CPEKFLTYVEMQLLYTKDKSYWEDYRQFCKTTAKPVKSLTQLLLDDDCPTAIFPSKPFLQ
RCFPDFSTKNGTLTIGSKMMFQDGNGGTRSVVELGIAANGINKLLDAKSLGLKVFEDYAR
TWYWILIGLTIAMVLSWIFLILLRFIAGCLFWVFMIGVIGIIGYGIWHCYQQYTNLQERP
SSVLTIYDIGIQTNISMYFELQQTWFTFMIILCIIEVIVILMLIFLRNRIRVAIILLKEG
SKAIGYVPSTLVYPALTFILLSICICYWVVTAVFLATSGVPVYKVIAPGGHCIHENQTCD
PEIFNTTEIAKACPGALCNFAFYGGKSLYHQYIPTFHVYNLFVFLWLINFVIALGQCALA
GAFATYYWAMKKPDDIPRYPLFTAFGRAIRYHTGSLAFGSLIIALIQMFKIVLEYLDHRL
KRTQNTLSKFLQCCLRCCFWCLENAIKFLNRNAYIMIAIYGRNFCRSAKDAFNLLMRNVL
KVAVTDEVTYFVLFLGKLLVAGSIGVLAFLFFTQRLPVIAQGPASLNYYWVPLLTVIFGS
YLIAHGFFSVYAMCVETIFICFCEDLERNDGSTEKPYFVTPNLHGILIKKQLVPQKQKE
Function This transmembrane tranporter mediates the biosynthetic process of phosphatidylcholine.
Endogenous Substrate(s) Choline
TCDB ID
2.A.92.1.5
Gene ID
204962
KEGG Pathway
Choline metabolism in cancer (hsa05231 )
Reactome Pathway
Transport of bile salts and organic acids, metal ions and amine compounds (R-HSA-425366 )
Synthesis of PC (R-HSA-1483191 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
CHOLINE DM5D9YK Insomnia 7A00-7A0Z Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 5.30E-06 2.11E-02 2.30E-01
Adrenocortical carcinoma 2D11.Z Kidney 7.25E-09 1.31E-01 1.30E+00
Alopecia ED70 Skin from scalp 1.45E-01 2.93E-01 3.93E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.47E-08 -2.20E-01 -6.71E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.78E-01 2.13E-02 2.27E-01
Aortic stenosis BB70 Calcified aortic valve 3.63E-01 1.16E-01 5.33E-01
Apnea 7A40 Hyperplastic tonsil 3.20E-01 -6.65E-01 -1.61E+00
Arthropathy FA00-FA5Z Peripheral blood 2.45E-01 9.46E-04 5.01E-03
Asthma CA23 Nasal and bronchial airway 3.87E-08 -4.67E-01 -4.84E-01
Atopic dermatitis EA80 Skin 6.72E-02 -2.22E-01 -2.34E-01
Autism 6A02 Whole blood 2.61E-01 3.97E-02 2.63E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.51E-01 -1.03E-02 -6.19E-02
Autosomal dominant monocytopenia 4B04 Whole blood 6.11E-01 7.15E-03 5.98E-02
Bacterial infection of gingival 1C1H Gingival tissue 1.38E-06 -6.17E-01 -8.38E-01
Batten disease 5C56.1 Whole blood 8.79E-01 2.11E-01 8.53E-01
Behcet's disease 4A62 Peripheral blood 2.43E-01 -1.69E-01 -9.51E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.73E-01 1.02E-01 4.08E-01
Bladder cancer 2C94 Bladder tissue 2.46E-01 1.26E-01 2.36E-01
Breast cancer 2C60-2C6Z Breast tissue 5.96E-09 6.53E-02 1.32E-01
Cardioembolic stroke 8B11.20 Whole blood 8.29E-01 -1.59E-02 -6.59E-02
Cervical cancer 2C77 Cervical tissue 2.14E-01 7.69E-01 8.46E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 3.21E-01 -4.25E-02 -1.63E-01
Chronic hepatitis C 1E51.1 Whole blood 9.97E-02 4.61E-02 4.44E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.76E-01 1.97E-02 1.09E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.42E-02 -1.34E-01 -1.88E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 9.29E-01 -9.03E-03 -3.52E-02
Colon cancer 2B90 Colon tissue 2.28E-02 -2.27E-01 -2.72E-01
Coronary artery disease BA80-BA8Z Peripheral blood 7.68E-02 -8.82E-02 -1.49E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.21E-01 4.74E-02 1.05E-01
Endometriosis GA10 Endometrium tissue 6.79E-02 2.66E-02 1.96E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.47E-01 2.99E-02 1.97E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.60E-02 -3.76E-02 -3.56E-01
Gastric cancer 2B72 Gastric tissue 1.69E-02 1.51E-01 1.09E+00
Glioblastopma 2A00.00 Nervous tissue 2.98E-24 4.42E-01 6.59E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.52E-06 9.94E-01 2.42E+00
Head and neck cancer 2D42 Head and neck tissue 1.70E-04 3.04E-01 3.53E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 4.41E-01 -6.26E-02 -1.60E-01
Huntington's disease 8A01.10 Whole blood 3.21E-01 -5.79E-02 -6.69E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 7.22E-02 3.71E-01 1.27E+00
Immunodeficiency 4A00-4A20 Peripheral blood 5.94E-01 5.40E-01 1.05E+00
Influenza 1.00E+30 Whole blood 5.02E-01 2.67E-02 3.03E-01
Interstitial cystitis GC00.3 Bladder tissue 4.89E-03 -6.61E-01 -3.05E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.35E-02 -2.13E-01 -9.93E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 3.05E-01 1.76E-01 2.53E-01
Ischemic stroke 8B11 Peripheral blood 6.21E-01 -2.22E-02 -1.84E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.86E-01 2.97E-02 1.08E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.04E-01 2.84E-02 2.20E-01
Lateral sclerosis 8B60.4 Skin 5.63E-01 2.64E-02 4.21E-01
Liver cancer 2C12.0 Liver tissue 2.22E-16 2.36E-01 1.10E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.15E-01 -1.54E-02 -1.22E-01
Lung cancer 2C25 Lung tissue 5.78E-107 9.61E-01 3.15E+00
Lupus erythematosus 4A40 Whole blood 1.98E-01 -5.13E-02 -1.61E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.22E-01 1.78E-02 9.94E-02
Major depressive disorder 6A70-6A7Z Hippocampus 4.58E-01 1.02E-01 4.01E-01
Melanoma 2C30 Skin 2.56E-03 -7.93E-01 -8.54E-01
Multiple myeloma 2A83.1 Bone marrow 6.36E-06 1.25E-02 2.37E-01
Multiple myeloma 2A83.1 Peripheral blood 9.89E-01 1.19E-03 5.45E-03
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.08E-01 2.24E-01 5.27E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.13E-01 -5.96E-02 -4.27E-01
Myelofibrosis 2A20.2 Whole blood 4.84E-01 -3.13E-03 -3.61E-02
Myocardial infarction BA41-BA50 Peripheral blood 9.29E-02 1.87E-01 3.44E-01
Myopathy 8C70.6 Muscle tissue 7.53E-01 -5.55E-01 -7.89E-01
Neonatal sepsis KA60 Whole blood 1.03E-04 -7.20E-02 -2.40E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.47E-20 1.40E+00 7.08E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.81E-02 -8.33E-02 -1.10E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 9.79E-02 -7.45E-02 -8.77E-01
Olive pollen allergy CA08.00 Peripheral blood 2.07E-01 -7.45E-02 -1.45E+00
Oral cancer 2B6E Oral tissue 6.15E-07 8.94E-01 1.36E+00
Osteoarthritis FA00-FA0Z Synovial tissue 9.13E-01 3.94E-02 1.21E-01
Osteoporosis FB83.1 Bone marrow 1.06E-01 3.72E-02 7.74E-01
Ovarian cancer 2C73 Ovarian tissue 3.09E-02 3.29E-01 8.92E-01
Pancreatic cancer 2C10 Pancreas 6.00E-05 4.05E-01 1.32E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 1.12E-01 -2.44E-01 -1.07E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.14E-01 -2.77E-01 -6.93E-01
Pituitary cancer 2D12 Pituitary tissue 6.18E-01 -7.57E-01 -2.49E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.10E-01 -8.81E-01 -2.76E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.92E-01 -3.89E-03 -8.03E-03
Polycythemia vera 2A20.4 Whole blood 9.92E-01 2.28E-03 2.31E-02
Pompe disease 5C51.3 Biceps muscle 4.62E-01 1.25E-01 8.94E-01
Preterm birth KA21.4Z Myometrium 5.14E-01 2.51E-04 3.16E-03
Prostate cancer 2C82 Prostate 4.53E-04 4.97E-02 1.39E-01
Psoriasis EA90 Skin 4.57E-01 1.01E-03 9.13E-04
Rectal cancer 2B92 Rectal colon tissue 9.56E-02 -1.18E+00 -1.36E+00
Renal cancer 2C90-2C91 Kidney 3.37E-02 -3.52E-01 -8.83E-01
Retinoblastoma 2D02.2 Uvea 1.53E-04 -2.34E-01 -1.86E+00
Rheumatoid arthritis FA20 Synovial tissue 2.80E-01 -7.41E-02 -1.86E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.76E-01 5.94E-02 1.39E-01
Schizophrenia 6A20 Prefrontal cortex 4.22E-02 -2.36E-01 -3.74E-01
Schizophrenia 6A20 Superior temporal cortex 4.48E-01 1.29E-02 6.81E-02
Scleroderma 4A42.Z Whole blood 4.19E-01 -3.79E-02 -2.43E-01
Seizure 8A60-8A6Z Whole blood 5.43E-02 6.19E-02 5.67E-01
Sensitive skin EK0Z Skin 7.13E-01 -8.94E-02 -1.66E-01
Sepsis with septic shock 1G41 Whole blood 1.70E-07 -4.38E-02 -1.66E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.46E-01 -2.41E-02 -1.64E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.24E-01 3.52E-02 4.29E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.41E-01 -4.26E-02 -9.25E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.30E-01 1.84E-01 1.41E+00
Skin cancer 2C30-2C3Z Skin 7.27E-20 -1.22E+00 -1.15E+00
Thrombocythemia 3B63 Whole blood 1.80E-01 -7.04E-03 -8.06E-02
Thrombocytopenia 3B64 Whole blood 5.55E-02 -1.05E-01 -9.50E-01
Thyroid cancer 2D10 Thyroid 2.89E-01 -3.21E-01 -7.61E-01
Tibial muscular dystrophy 8C75 Muscle tissue 1.12E-03 -1.38E+00 -1.24E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.51E-01 -4.34E-01 -7.28E-01
Type 2 diabetes 5A11 Liver tissue 4.91E-01 3.52E-02 4.57E-01
Ureter cancer 2C92 Urothelium 6.98E-01 -2.58E-02 -3.46E-01
Uterine cancer 2C78 Endometrium tissue 2.85E-21 3.73E-01 1.01E+00
Vitiligo ED63.0 Skin 9.12E-01 7.34E-02 5.14E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 The molecular effects of a polymorphism in the 5'UTR of solute carrier family 44, member 5 that is associated with birth weight in Holsteins. PLoS One. 2012;7(7):e41267.