Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTUO05P)

DTP Name Sodium/dicarboxylate cotransporter 1 (SLC13A2)
Gene Name SLC13A2
UniProt ID
Q13183 (S13A2_HUMAN)
VARIDT ID
DTD0092
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms NADC1; Na(+)/dicarboxylate cotransporter 1; NaDC-1; SDCT1; SLC13A2; Solute carrier family 13 member 2; Renal sodium/dicarboxylate cotransporter
DTP Family Divalent Anion:Na(+) Symporter (DASS) Family ;
Sequence
MATCWQALWAYRSYLIVFFVPILLLPLPILVPSKEAYCAYAIILMALFWCTEALPLAVTA
LFPLILFPMMGIVDASEVAVEYLKDSNLLFFGGLLVAIAVEHWNLHKRIALRVLLIVGVR
PAPLILGFMLVTAFLSMWISNTATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQ
EPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQCMSLCVCYSASIGGIATLTGT
APNLVLQGQINSLFPQNGNVVNFASWFSFAFPTMVILLLLAWLWLQILFLGFNFRKNFGI
GEKMQEQQQAAYCVIQTEHRLLGPMTFAEKAISILFVILVLLWFTREPGFFLGWGNLAFP
NAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLDWKTVNQKMPWN
IVLLLGGGYALAKGSERSGLSEWLGNKLTPLQSVPAPAIAIILSLLVATFTECTSNVATT
TIFLPILASMAQAICLHPLYVMLPCTLATSLAFMLPVATPPNAIVFSFGDLKVLDMARAG
FLLNIIGVLIIALAINSWGIPLFSLHSFPSWAQSNTTAQCLPSLANTTTPSP
Function This cotransport mediates the transporter of sodium ions and dicarboxylates, such as succinate and citrate.
Endogenous Substrate(s) Citrate; Na+; Dicarboxylates
TCDB ID
2.A.47.1.17
Gene ID
9058
Reactome Pathway
Sodium-coupled sulphate, di- and tri-carboxylate transporters (R-HSA-433137 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Dicarboxylate DML3HEM N. A. N. A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 9.06E-01 2.10E-02 1.02E-01
Adrenocortical carcinoma 2D11.Z Kidney 9.65E-01 -1.24E-01 -5.82E-01
Alopecia ED70 Skin from scalp 4.99E-04 2.36E-01 5.59E-01
Alzheimer's disease 8A20 Entorhinal cortex 2.22E-01 -2.02E-02 -1.81E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.19E-01 -4.93E-03 -1.06E-01
Aortic stenosis BB70 Calcified aortic valve 9.98E-01 7.64E-02 1.07E-01
Apnea 7A40 Hyperplastic tonsil 3.80E-01 -5.02E-02 -3.08E-01
Arthropathy FA00-FA5Z Peripheral blood 4.86E-01 7.02E-02 5.68E-01
Asthma CA23 Nasal and bronchial airway 3.35E-05 -1.30E-01 -2.11E-01
Atopic dermatitis EA80 Skin 7.36E-03 1.74E-01 5.33E-01
Autism 6A02 Whole blood 7.05E-01 3.23E-02 1.77E-01
Autoimmune uveitis 9A96 Peripheral monocyte 3.01E-02 -1.02E-01 -7.81E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.27E-02 -2.19E-02 -2.03E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.24E-01 6.42E-02 3.66E-01
Batten disease 5C56.1 Whole blood 3.60E-01 7.57E-02 6.73E-01
Behcet's disease 4A62 Peripheral blood 9.29E-01 2.32E-02 1.81E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.88E-01 -2.78E-02 -2.36E-01
Bladder cancer 2C94 Bladder tissue 5.02E-02 9.82E-02 7.21E-01
Breast cancer 2C60-2C6Z Breast tissue 6.20E-55 -8.98E-01 -1.26E+00
Cardioembolic stroke 8B11.20 Whole blood 4.31E-02 -9.06E-02 -8.69E-01
Cervical cancer 2C77 Cervical tissue 1.26E-01 -5.70E-02 -2.48E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.74E-01 -3.12E-02 -1.69E-01
Chronic hepatitis C 1E51.1 Whole blood 3.80E-02 5.40E-02 7.57E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.51E-01 5.83E-02 3.54E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.43E-03 -5.62E-02 -1.69E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.22E-01 5.27E-03 3.04E-02
Colon cancer 2B90 Colon tissue 1.82E-48 -1.36E+00 -1.97E+00
Coronary artery disease BA80-BA8Z Peripheral blood 1.27E-01 -3.97E-01 -9.79E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.13E-01 -7.55E-02 -3.67E-01
Endometriosis GA10 Endometrium tissue 8.80E-01 1.62E-02 1.13E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.03E-02 1.09E-01 8.32E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.30E-03 -2.02E-01 -9.16E-01
Gastric cancer 2B72 Gastric tissue 4.53E-03 2.69E-01 2.80E+00
Glioblastopma 2A00.00 Nervous tissue 2.83E-38 -1.53E-01 -9.86E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 3.72E-05 -8.44E-01 -2.43E+00
Head and neck cancer 2D42 Head and neck tissue 6.70E-09 -2.65E-01 -5.90E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.31E-02 -6.86E-02 -8.43E-01
Huntington's disease 8A01.10 Whole blood 3.96E-01 -1.40E-02 -8.61E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.16E-01 1.58E-02 8.55E-02
Immunodeficiency 4A00-4A20 Peripheral blood 7.70E-01 5.54E-02 5.28E-01
Influenza 1.00E+30 Whole blood 1.36E-01 2.02E-01 9.39E-01
Interstitial cystitis GC00.3 Bladder tissue 1.57E-02 1.69E-01 2.02E+00
Intracranial aneurysm 8B01.0 Intracranial artery 7.29E-01 -6.54E-02 -4.64E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.30E-03 -4.34E-01 -7.82E-01
Ischemic stroke 8B11 Peripheral blood 7.61E-02 1.59E-02 1.37E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.66E-04 1.28E-01 5.97E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.92E-01 3.17E-01 1.15E+00
Lateral sclerosis 8B60.4 Skin 2.69E-01 -4.06E-02 -1.63E+00
Liver cancer 2C12.0 Liver tissue 3.36E-03 -2.54E-01 -1.03E+00
Liver failure DB99.7-DB99.8 Liver tissue 9.15E-03 -3.10E-01 -1.67E+00
Lung cancer 2C25 Lung tissue 5.79E-01 -7.47E-02 -3.45E-01
Lupus erythematosus 4A40 Whole blood 2.99E-01 -6.31E-02 -1.61E-01
Major depressive disorder 6A70-6A7Z Whole blood 5.57E-01 1.87E-02 1.08E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.35E-01 5.19E-03 4.75E-02
Melanoma 2C30 Skin 8.35E-06 -6.51E-01 -9.47E-01
Multiple myeloma 2A83.1 Bone marrow 6.99E-01 2.81E-02 2.47E-01
Multiple myeloma 2A83.1 Peripheral blood 4.56E-01 -5.75E-02 -5.05E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.82E-01 -8.98E-03 -3.36E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.56E-01 -4.17E-02 -3.43E-01
Myelofibrosis 2A20.2 Whole blood 3.74E-02 1.56E-01 9.72E-01
Myocardial infarction BA41-BA50 Peripheral blood 9.61E-02 3.87E-01 9.06E-01
Myopathy 8C70.6 Muscle tissue 1.10E-03 -1.48E-01 -2.68E+00
Neonatal sepsis KA60 Whole blood 1.14E-03 -1.26E-01 -5.92E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.04E-02 -1.07E-01 -6.94E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 5.42E-02 8.53E-02 1.78E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.39E-01 1.12E-01 1.57E+00
Olive pollen allergy CA08.00 Peripheral blood 9.98E-01 -4.26E-03 -3.29E-02
Oral cancer 2B6E Oral tissue 1.06E-02 -9.90E-02 -2.25E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.18E-01 -7.93E-02 -3.18E-01
Osteoporosis FB83.1 Bone marrow 1.85E-02 1.78E-01 1.40E+00
Ovarian cancer 2C73 Ovarian tissue 2.49E-01 -3.93E-02 -3.70E-01
Pancreatic cancer 2C10 Pancreas 1.42E-02 -4.58E-01 -1.33E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 4.91E-01 5.81E-02 3.73E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.17E-01 -9.87E-03 -1.25E-01
Pituitary cancer 2D12 Pituitary tissue 2.03E-03 2.44E-01 1.64E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.97E-02 1.24E-01 9.86E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 2.88E-01 2.46E-03 2.39E-02
Polycythemia vera 2A20.4 Whole blood 2.46E-02 1.05E-01 5.93E-01
Pompe disease 5C51.3 Biceps muscle 3.49E-01 -6.57E-02 -6.58E-01
Preterm birth KA21.4Z Myometrium 8.32E-01 4.94E-03 2.78E-02
Prostate cancer 2C82 Prostate 8.84E-01 -9.79E-02 -2.95E-01
Psoriasis EA90 Skin 1.26E-09 -3.44E-01 -8.62E-01
Rectal cancer 2B92 Rectal colon tissue 2.77E-05 -1.74E+00 -4.93E+00
Renal cancer 2C90-2C91 Kidney 3.90E-04 -1.84E+00 -1.89E+00
Retinoblastoma 2D02.2 Uvea 1.99E-05 -2.65E-01 -1.71E+00
Rheumatoid arthritis FA20 Synovial tissue 6.29E-03 -4.46E-01 -1.73E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.25E-01 5.31E-02 2.92E-01
Schizophrenia 6A20 Prefrontal cortex 5.10E-01 -6.88E-03 -5.19E-02
Schizophrenia 6A20 Superior temporal cortex 9.53E-01 -7.23E-03 -8.42E-02
Scleroderma 4A42.Z Whole blood 5.69E-04 2.28E-01 2.26E+00
Seizure 8A60-8A6Z Whole blood 3.80E-01 -1.09E-01 -5.64E-01
Sensitive skin EK0Z Skin 7.80E-02 -3.11E-01 -6.32E-01
Sepsis with septic shock 1G41 Whole blood 6.77E-02 -2.82E-02 -1.39E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.21E-01 3.15E-02 5.50E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.45E-01 7.76E-02 4.57E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.97E-03 2.04E-01 5.14E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.39E-01 -1.30E-01 -6.57E-01
Skin cancer 2C30-2C3Z Skin 1.90E-59 -7.32E-01 -1.58E+00
Thrombocythemia 3B63 Whole blood 1.09E-01 6.72E-02 3.95E-01
Thrombocytopenia 3B64 Whole blood 8.33E-01 -4.77E-02 -2.40E-01
Thyroid cancer 2D10 Thyroid 9.91E-04 8.36E-02 4.53E-01
Tibial muscular dystrophy 8C75 Muscle tissue 6.12E-05 -2.74E-01 -1.63E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.44E-03 2.25E-01 4.44E+00
Type 2 diabetes 5A11 Liver tissue 4.92E-02 -3.18E-01 -1.34E+00
Ureter cancer 2C92 Urothelium 9.53E-01 3.73E-02 1.98E-01
Uterine cancer 2C78 Endometrium tissue 1.51E-01 2.93E-02 1.31E-01
Vitiligo ED63.0 Skin 6.79E-01 -1.96E-02 -2.29E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Evidence for epistatic interaction between VDR and SLC13A2 genes in the pathogenesis of hypocitraturia in recurrent calcium oxalate stone formers. J Nephrol. 2017 Jun;30(3):411-418.