Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTV9AFB)

DTP Name Mitochondrial brown fat uncoupling protein 1 (SLC25A7)
Gene Name SLC25A7
UniProt ID
P25874 (UCP1_HUMAN)
VARIDT ID
DTD0224
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms SLC25A7; Solute carrier family 25 member 7; Thermogenin; UCP; UCP 1; UCP1
DTP Family Mitochondrial Carrier (MC) Family ;
Tissue Specificity Expressed in brown adipose tissue.
Sequence
MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLG
TITAVVKTEGRMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAG
LTTGGVAVFIGQPTEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPN
LMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRF
INSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGSWNVIMFVCFEQLKRELSKSR
QTMDCAT
Function This transporter functions as a long-chain fatty acid/LCFA and proton symporter, simultaneously transporting one LCFA and one proton through the inner mitochondrial membrane.
Endogenous Substrate(s) H+; Cl-; Fatty acids
TCDB ID
2.A.29.3.2
Gene ID
7350
KEGG Pathway
PPAR signaling pathway (hsa03320 )
Apelin signaling pathway (hsa04371 )
Thermogenesis (hsa04714 )
Huntington disease (hsa05016 )
Reactome Pathway
The proton buffering model (R-HSA-167827 )
The fatty acid cycling model (R-HSA-167826 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.17E-02 2.47E-02 1.07E-01
Adrenocortical carcinoma 2D11.Z Kidney 6.49E-02 -1.31E-01 -2.02E-01
Alopecia ED70 Skin from scalp 6.63E-01 2.45E-02 1.37E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.09E-01 -1.68E-03 -1.24E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 3.06E-01 -1.91E-01 -9.62E-01
Aortic stenosis BB70 Calcified aortic valve 3.14E-01 8.09E-02 3.25E-01
Apnea 7A40 Hyperplastic tonsil 3.93E-02 -2.21E-01 -1.32E+00
Arthropathy FA00-FA5Z Peripheral blood 5.15E-02 -9.93E-02 -5.37E-01
Asthma CA23 Nasal and bronchial airway 9.53E-02 -1.01E-02 -2.74E-02
Atopic dermatitis EA80 Skin 2.90E-01 0.00E+00 0.00E+00
Autism 6A02 Whole blood 8.77E-01 1.19E-02 4.81E-02
Autoimmune uveitis 9A96 Peripheral monocyte 2.79E-03 1.64E-01 9.29E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.33E-01 -1.34E-02 -1.38E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.02E-03 7.96E-02 3.91E-01
Batten disease 5C56.1 Whole blood 2.86E-01 4.22E-02 3.43E-01
Behcet's disease 4A62 Peripheral blood 6.54E-01 9.84E-02 3.84E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.95E-01 2.68E-02 1.67E-01
Bladder cancer 2C94 Bladder tissue 5.35E-03 4.13E-01 1.65E+00
Breast cancer 2C60-2C6Z Breast tissue 1.15E-17 -2.49E-01 -7.28E-01
Cardioembolic stroke 8B11.20 Whole blood 5.25E-01 2.17E-02 9.06E-02
Cervical cancer 2C77 Cervical tissue 2.50E-01 -8.10E-02 -3.64E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.73E-01 -4.20E-02 -1.47E-01
Chronic hepatitis C 1E51.1 Whole blood 4.26E-01 -1.05E-01 -5.62E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.02E-01 8.63E-03 4.83E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.24E-02 8.32E-02 4.69E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.07E-01 1.66E-02 1.86E-01
Colon cancer 2B90 Colon tissue 4.60E-04 -2.61E-02 -1.15E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.75E-01 -6.35E-02 -2.13E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.22E-01 9.30E-02 3.07E-01
Endometriosis GA10 Endometrium tissue 7.78E-01 8.10E-03 3.44E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 3.25E-01 3.89E-02 2.78E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.23E-04 -2.36E-01 -8.93E-01
Gastric cancer 2B72 Gastric tissue 8.54E-01 -3.95E-02 -8.98E-02
Glioblastopma 2A00.00 Nervous tissue 1.55E-25 -1.56E-01 -6.74E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.51E-01 -8.57E-02 -3.10E-01
Head and neck cancer 2D42 Head and neck tissue 3.08E-03 -8.55E-02 -5.55E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.92E-01 -7.83E-02 -3.65E-01
Huntington's disease 8A01.10 Whole blood 7.54E-01 -1.03E-03 -6.53E-03
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.44E-01 -1.32E-01 -9.05E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.94E-02 5.55E-02 6.51E-01
Influenza 1.00E+30 Whole blood 4.14E-02 3.34E-01 4.80E+00
Interstitial cystitis GC00.3 Bladder tissue 5.66E-01 -6.21E-03 -6.22E-02
Intracranial aneurysm 8B01.0 Intracranial artery 3.23E-01 -7.24E-02 -3.03E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.89E-01 -4.54E-02 -1.62E-01
Ischemic stroke 8B11 Peripheral blood 4.78E-03 1.91E-01 1.15E+00
Juvenile idiopathic arthritis FA24 Peripheral blood 2.80E-03 1.54E-01 6.79E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.74E-01 -9.33E-03 -5.69E-02
Lateral sclerosis 8B60.4 Skin 4.48E-01 -1.32E-01 -1.08E+00
Liver cancer 2C12.0 Liver tissue 4.30E-02 -3.87E-02 -2.27E-01
Liver failure DB99.7-DB99.8 Liver tissue 3.63E-01 8.65E-02 4.45E-01
Lung cancer 2C25 Lung tissue 1.43E-01 -7.41E-02 -3.63E-01
Lupus erythematosus 4A40 Whole blood 2.09E-01 3.84E-02 1.04E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.83E-01 2.16E-02 1.13E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.01E-01 5.75E-02 4.27E-01
Melanoma 2C30 Skin 6.77E-01 3.17E-02 7.23E-02
Multiple myeloma 2A83.1 Bone marrow 4.94E-02 -1.67E-01 -8.81E-01
Multiple myeloma 2A83.1 Peripheral blood 5.55E-01 3.90E-02 2.37E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.24E-01 -5.09E-02 -3.02E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.39E-01 3.01E-02 1.94E-01
Myelofibrosis 2A20.2 Whole blood 3.32E-01 2.28E-02 1.22E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.63E-01 2.75E-02 4.92E-02
Myopathy 8C70.6 Muscle tissue 2.57E-01 -1.02E-01 -6.39E-01
Neonatal sepsis KA60 Whole blood 5.60E-02 5.99E-02 2.40E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.37E-02 -4.00E-01 -7.62E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 9.36E-01 2.51E-02 2.58E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 2.17E-01 7.77E-02 7.23E-01
Olive pollen allergy CA08.00 Peripheral blood 2.50E-01 2.00E-01 7.68E-01
Oral cancer 2B6E Oral tissue 3.99E-05 -3.00E-01 -1.06E+00
Osteoarthritis FA00-FA0Z Synovial tissue 3.22E-01 -1.11E-01 -3.54E-01
Osteoporosis FB83.1 Bone marrow 7.68E-02 8.92E-02 8.03E-01
Ovarian cancer 2C73 Ovarian tissue 2.01E-02 -1.70E-01 -9.62E-01
Pancreatic cancer 2C10 Pancreas 2.31E-02 -3.89E-01 -6.96E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.09E-01 -3.25E-02 -1.34E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.94E-01 -1.97E-02 -1.53E-01
Pituitary cancer 2D12 Pituitary tissue 4.03E-02 1.98E-01 9.03E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.23E-01 -7.94E-03 -3.89E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.27E-01 -3.61E-02 -1.99E-01
Polycythemia vera 2A20.4 Whole blood 2.24E-01 -1.75E-02 -7.88E-02
Pompe disease 5C51.3 Biceps muscle 1.19E-02 -1.47E-01 -1.03E+00
Preterm birth KA21.4Z Myometrium 2.95E-01 -2.20E-02 -1.31E-01
Prostate cancer 2C82 Prostate 3.98E-01 -7.78E-02 -1.66E-01
Psoriasis EA90 Skin 7.81E-02 -4.96E-02 -1.59E-01
Rectal cancer 2B92 Rectal colon tissue 8.05E-03 -1.02E-01 -1.31E+00
Renal cancer 2C90-2C91 Kidney 5.54E-02 -2.02E-01 -9.40E-01
Retinoblastoma 2D02.2 Uvea 1.09E-04 -2.81E-01 -2.75E+00
Rheumatoid arthritis FA20 Synovial tissue 1.71E-02 -3.52E-01 -1.01E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.30E-01 3.39E-03 2.51E-02
Schizophrenia 6A20 Prefrontal cortex 4.04E-01 6.09E-02 2.84E-01
Schizophrenia 6A20 Superior temporal cortex 1.55E-01 -8.21E-02 -5.82E-01
Scleroderma 4A42.Z Whole blood 1.67E-01 1.42E-01 6.56E-01
Seizure 8A60-8A6Z Whole blood 5.33E-02 -1.70E-01 -7.04E-01
Sensitive skin EK0Z Skin 4.18E-01 1.38E-01 6.98E-01
Sepsis with septic shock 1G41 Whole blood 2.46E-03 6.47E-02 2.44E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.99E-02 2.91E-01 1.02E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.69E-01 9.39E-03 4.10E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 6.94E-01 4.89E-01 3.10E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.16E-01 3.20E-02 2.09E-01
Skin cancer 2C30-2C3Z Skin 6.79E-04 -8.90E-02 -2.79E-01
Thrombocythemia 3B63 Whole blood 1.63E-01 8.88E-02 4.83E-01
Thrombocytopenia 3B64 Whole blood 3.38E-01 1.86E+00 1.54E+00
Thyroid cancer 2D10 Thyroid 2.94E-02 1.05E-02 5.18E-02
Tibial muscular dystrophy 8C75 Muscle tissue 4.34E-01 -5.10E-02 -3.13E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.89E-01 9.87E-02 9.71E-01
Type 2 diabetes 5A11 Liver tissue 1.68E-01 -3.55E-01 -1.23E+00
Ureter cancer 2C92 Urothelium 7.48E-01 -7.90E-02 -4.31E-01
Uterine cancer 2C78 Endometrium tissue 1.06E-02 1.00E-01 4.29E-01
Vitiligo ED63.0 Skin 4.05E-01 2.41E-02 1.46E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Mitochondrial uncoupling protein 1 (UCP1) DTT Info
DTP DTT Type Clinical trial
1 Clinical Trial Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
CL-316,243 DMXH1KC Obesity 5B81 Phase 2 [1]
------------------------------------------------------------------------------------
1 Investigative Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
NC-2100 DMJKZUC Discovery agent N.A. Investigative [2]
------------------------------------------------------------------------------------

References

1 Anti-obesity and anti-diabetic effects of CL316,243, a highly specific beta 3-adrenoceptor agonist, in Otsuka Long-Evans Tokushima Fatty rats: induction of uncoupling protein and activation of glucose transporter 4 in white fat. Eur J Endocrinol. 1997 Apr;136(4):429-37.
2 A new thiazolidinedione, NC-2100, which is a weak PPAR-gamma activator, exhibits potent antidiabetic effects and induces uncoupling protein 1 in white adipose tissue of KKAy obese mice. Diabetes. 2000 May;49(5):759-67.