Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTVL2JY)

DTP Name Asc-type amino acid transporter 1 (SLC7A10)
Gene Name SLC7A10
UniProt ID
Q9NS82 (AAA1_HUMAN)
VARIDT ID
DTD0463
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms ASC1; Asc-1; HASC-1; SLC7A10; Solute carrier family 7 member 10
DTP Family Amino Acid-Polyamine-Organocation (APC) Family
L-type Amino Acid Transporter (LAT) Family
Tissue Specificity Expressed in brain, heart, kidney, liver,lung, pancreas, placenta, and skeletal muscle.
Sequence
MAGHTQQPSGRGNPRPAPSPSPVPGTVPGASERVALKKEIGLLSACTIIIGNIIGSGIFI
SPKGVLEHSGSVGLALFVWVLGGGVTALGSLCYAELGVAIPKSGGDYAYVTEIFGGLAGF
LLLWSAVLIMYPTSLAVISMTFSNYVLQPVFPNCIPPTTASRVLSMACLMLLTWVNSSSV
RWATRIQDMFTGGKLLALSLIIGVGLLQIFQGHFEELRPSNAFAFWMTPSVGHLALAFLQ
GSFAFSGWNFLNYVTEEMVDARKNLPRAIFISIPLVTFVYTFTNIAYFTAMSPQELLSSN
AVAVTFGEKLLGYFSWVMPVSVALSTFGGINGYLFTYSRLCFSGAREGHLPSLLAMIHVR
HCTPIPALLVCCGATAVIMLVGDTYTLINYVSFINYLCYGVTILGLLLLRWRRPALHRPI
KVNLLIPVAYLVFWAFLLVFSFISEPMVCGVGVIIILTGVPIFFLGVFWRSKPKCVHRLT
ESMTHWGQELCFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ
Function
This sodium-independent, high affinity transporter mediates the transport of neutral D- and L-amino acids and may play a role in the modulation of glutamatergic transmission through mobilization of D-serine at the glutamatergic synapse.
Endogenous Substrate(s) D-amino acids; L-amino acids
TCDB ID
2.A.3.8.21
Gene ID
56301
Reactome Pathway
Amino acid transport across the plasma membrane (R-HSA-352230 )
Basigin interactions (R-HSA-210991 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.14E-02 1.10E-01 4.59E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.77E-01 -1.30E-01 -4.55E-01
Alopecia ED70 Skin from scalp 5.64E-02 2.65E-01 4.19E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.42E-01 1.09E-01 2.49E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.57E-01 -1.29E-02 -1.03E-01
Aortic stenosis BB70 Calcified aortic valve 5.16E-01 -1.99E-01 -3.55E-01
Apnea 7A40 Hyperplastic tonsil 3.48E-01 1.19E-01 1.22E+00
Arthropathy FA00-FA5Z Peripheral blood 3.92E-01 9.41E-02 5.76E-01
Asthma CA23 Nasal and bronchial airway 8.30E-02 -7.24E-02 -2.24E-01
Atopic dermatitis EA80 Skin 4.22E-01 -1.23E-01 -2.20E-01
Autism 6A02 Whole blood 5.53E-01 -3.36E-03 -1.18E-02
Autoimmune uveitis 9A96 Peripheral monocyte 3.73E-02 -2.89E-01 -2.41E+00
Autosomal dominant monocytopenia 4B04 Whole blood 6.36E-02 -1.83E-01 -9.58E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.32E-02 8.62E-02 3.70E-01
Batten disease 5C56.1 Whole blood 8.31E-01 5.53E-02 2.31E-01
Behcet's disease 4A62 Peripheral blood 2.03E-01 -1.49E-01 -5.59E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.15E-02 8.54E-02 2.79E-01
Bladder cancer 2C94 Bladder tissue 2.83E-04 3.76E-01 2.03E+00
Breast cancer 2C60-2C6Z Breast tissue 8.01E-49 -1.51E+00 -1.12E+00
Cardioembolic stroke 8B11.20 Whole blood 2.59E-06 1.91E-01 1.28E+00
Cervical cancer 2C77 Cervical tissue 5.33E-01 4.83E-02 1.64E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.36E-01 -4.95E-02 -1.70E-01
Chronic hepatitis C 1E51.1 Whole blood 2.40E-01 7.35E-02 4.77E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.37E-01 3.53E-02 1.39E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.89E-05 1.87E-01 6.93E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 3.77E-01 -1.83E-01 -1.05E+00
Colon cancer 2B90 Colon tissue 2.22E-01 -3.65E-02 -1.08E-01
Coronary artery disease BA80-BA8Z Peripheral blood 9.49E-01 -7.46E-02 -2.50E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.46E-01 3.19E-02 1.62E-01
Endometriosis GA10 Endometrium tissue 6.49E-01 -4.58E-02 -1.37E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.29E-02 7.83E-02 5.13E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.43E-01 -7.17E-03 -3.18E-02
Gastric cancer 2B72 Gastric tissue 2.11E-01 -5.30E-01 -1.77E+00
Glioblastopma 2A00.00 Nervous tissue 1.07E-109 -1.29E+00 -2.06E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.64E-02 -2.07E-01 -3.66E-01
Head and neck cancer 2D42 Head and neck tissue 6.16E-01 3.65E-02 1.55E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.50E-01 -1.19E-01 -2.75E-01
Huntington's disease 8A01.10 Whole blood 7.63E-01 6.55E-02 2.26E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.93E-02 -1.33E-01 -1.19E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.40E-01 5.31E-02 5.73E-01
Influenza 1.00E+30 Whole blood 1.29E-01 1.50E-01 9.18E-01
Interstitial cystitis GC00.3 Bladder tissue 6.91E-01 -3.75E-02 -2.61E-01
Intracranial aneurysm 8B01.0 Intracranial artery 9.70E-03 -2.93E-01 -7.68E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.24E-01 1.54E-01 5.53E-01
Ischemic stroke 8B11 Peripheral blood 8.88E-01 -2.83E-02 -1.83E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 4.13E-02 1.01E-01 3.23E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 8.08E-03 2.98E-01 1.38E+00
Lateral sclerosis 8B60.4 Skin 3.45E-01 4.73E-02 1.13E+00
Liver cancer 2C12.0 Liver tissue 1.95E-01 -8.67E-02 -2.84E-01
Liver failure DB99.7-DB99.8 Liver tissue 6.65E-03 -2.09E-01 -1.56E+00
Lung cancer 2C25 Lung tissue 3.47E-07 8.94E-02 3.18E-01
Lupus erythematosus 4A40 Whole blood 8.00E-01 -4.32E-03 -1.12E-02
Major depressive disorder 6A70-6A7Z Whole blood 1.50E-04 1.46E-01 7.15E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.69E-01 -7.51E-03 -2.48E-02
Melanoma 2C30 Skin 3.32E-02 -2.78E-01 -6.35E-01
Multiple myeloma 2A83.1 Bone marrow 5.18E-01 -6.83E-02 -5.34E-01
Multiple myeloma 2A83.1 Peripheral blood 7.07E-01 1.13E-01 3.75E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.31E-01 3.20E-01 6.78E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.86E-02 -9.05E-02 -4.94E-01
Myelofibrosis 2A20.2 Whole blood 9.19E-02 8.69E-02 6.20E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.12E-01 4.93E-02 1.79E-01
Myopathy 8C70.6 Muscle tissue 1.18E-01 -3.64E-01 -1.22E+00
Neonatal sepsis KA60 Whole blood 4.41E-03 1.45E-01 3.75E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.82E-05 -1.20E+00 -2.89E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.56E-01 -1.11E-01 -4.23E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.88E-03 7.61E-01 1.70E+00
Olive pollen allergy CA08.00 Peripheral blood 8.26E-01 2.07E-02 9.24E-02
Oral cancer 2B6E Oral tissue 1.50E-07 -6.54E-01 -1.52E+00
Osteoarthritis FA00-FA0Z Synovial tissue 1.20E-01 -2.60E-01 -6.11E-01
Osteoporosis FB83.1 Bone marrow 4.95E-01 3.58E-02 1.06E-01
Ovarian cancer 2C73 Ovarian tissue 2.45E-01 -2.21E-01 -5.44E-01
Pancreatic cancer 2C10 Pancreas 2.74E-02 -3.48E-01 -5.04E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.73E-01 -2.68E-01 -3.56E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.85E-01 -1.61E-02 -8.99E-02
Pituitary cancer 2D12 Pituitary tissue 1.71E-02 1.42E-01 7.42E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.55E-02 4.87E-02 2.74E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.40E-01 -3.80E-02 -1.76E-01
Polycythemia vera 2A20.4 Whole blood 6.50E-08 1.90E-01 1.49E+00
Pompe disease 5C51.3 Biceps muscle 4.61E-02 -1.63E-01 -8.82E-01
Preterm birth KA21.4Z Myometrium 2.38E-01 -1.37E-01 -6.71E-01
Prostate cancer 2C82 Prostate 2.40E-01 -2.15E-01 -5.01E-01
Psoriasis EA90 Skin 9.65E-01 3.69E-02 9.10E-02
Rectal cancer 2B92 Rectal colon tissue 2.55E-01 8.90E-02 6.09E-01
Renal cancer 2C90-2C91 Kidney 1.46E-04 -5.29E-01 -1.73E+00
Retinoblastoma 2D02.2 Uvea 2.68E-01 -1.86E-01 -1.11E+00
Rheumatoid arthritis FA20 Synovial tissue 1.09E-02 -5.30E-01 -1.32E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 8.89E-01 -4.75E-03 -3.12E-02
Schizophrenia 6A20 Prefrontal cortex 1.78E-01 -1.11E-01 -2.03E-01
Schizophrenia 6A20 Superior temporal cortex 1.35E-01 -6.03E-02 -3.02E-01
Scleroderma 4A42.Z Whole blood 3.02E-03 -3.23E-01 -1.34E+00
Seizure 8A60-8A6Z Whole blood 1.01E-01 2.03E-01 1.01E+00
Sensitive skin EK0Z Skin 8.64E-01 1.81E-02 5.70E-02
Sepsis with septic shock 1G41 Whole blood 3.07E-01 -1.13E-02 -3.18E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.35E-01 6.22E-02 2.70E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.71E-01 1.53E-01 8.82E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 7.18E-01 -1.64E-02 -3.79E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.08E-01 -1.46E-02 -3.22E-01
Skin cancer 2C30-2C3Z Skin 6.19E-05 -9.36E-02 -2.03E-01
Thrombocythemia 3B63 Whole blood 1.18E-01 3.95E-02 3.09E-01
Thrombocytopenia 3B64 Whole blood 3.76E-01 3.15E-01 5.39E-01
Thyroid cancer 2D10 Thyroid 6.90E-03 4.43E-02 1.86E-01
Tibial muscular dystrophy 8C75 Muscle tissue 5.40E-02 -3.49E-01 -1.01E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.27E-01 4.88E-01 1.77E+00
Type 2 diabetes 5A11 Liver tissue 4.66E-01 -1.44E-02 -7.12E-02
Ureter cancer 2C92 Urothelium 5.96E-01 -8.29E-02 -6.40E-01
Uterine cancer 2C78 Endometrium tissue 3.28E-01 1.89E-03 5.99E-03
Vitiligo ED63.0 Skin 5.69E-01 -3.40E-02 -6.27E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases