Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTVY9PJ)

DTP Name Sodium-dependent vitamin C transporter 2 (SLC23A2)
Gene Name SLC23A2
UniProt ID
Q9UGH3 (S23A2_HUMAN)
VARIDT ID
DTD0159
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms KIAA0238; NBTL1; Na(+)/L-ascorbic acid transporter 2; Nucleobase transporter-like 1 protein; SLC23A2; SVCT2; Solute carrier family 23 member 2; YSPL2; Yolk sac permease-like molecule 2; hSVCT2
DTP Family Nucleobase/Ascorbate Transporter (NAT) Or Nucleobase:Cation Symporter-2 (NCS2) Family ;
Tissue Specificity Ubiquitous.
Sequence
MMGIGKNTTSKSMEAGSSTEGKYEDEAKHPAFFTLPVVINGGATSSGEQDNEDTELMAIY
TTENGIAEKSSLAETLDSTGSLDPQRSDMIYTIEDVPPWYLCIFLGLQHYLTCFSGTIAV
PFLLADAMCVGYDQWATSQLIGTIFFCVGITTLLQTTFGCRLPLFQASAFAFLAPARAIL
SLDKWKCNTTDVSVANGTAELLHTEHIWYPRIREIQGAIIMSSLIEVVIGLLGLPGALLK
YIGPLTITPTVALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK
KGWTAYKLQLFKMFPIILAILVSWLLCFIFTVTDVFPPDSTKYGFYARTDARQGVLLVAP
WFKVPYPFQWGLPTVSAAGVIGMLSAVVASIIESIGDYYACARLSCAPPPPIHAINRGIF
VEGLSCVLDGIFGTGNGSTSSSPNIGVLGITKVGSRRVIQCGAALMLALGMIGKFSALFA
SLPDPVLGALFCTLFGMITAVGLSNLQFIDLNSSRNLFVLGFSIFFGLVLPSYLRQNPLV
TGITGIDQVLNVLLTTAMFVGGCVAFILDNTIPGTPEERGIRKWKKGVGKGNKSLDGMES
YNLPFGMNIIKKYRCFSYLPISPTFVGYTWKGLRKSDNSRSSDEDSQATG
Function This sodium/ascorbate cotransporter mediates electrogenic uptake of vitamin C, with a stoichiometry of 2 Na(+) for each ascorbate.
Endogenous Substrate(s) Ca2+; Mg2+; Na+
TCDB ID
2.A.40.6.2
Gene ID
9962
Reactome Pathway
Vitamin C (ascorbate) metabolism (R-HSA-196836 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Approved Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Vitamin C DMXJ7O8 Vitamin C deficiency 5B56 Approved [4]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 3.64E-05 8.55E-02 3.45E-01
Adrenocortical carcinoma 2D11.Z Kidney 3.62E-01 -8.02E-03 -8.51E-03
Alopecia ED70 Skin from scalp 2.99E-01 -5.19E-02 -1.69E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.59E-06 -4.47E-01 -9.05E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.13E-01 -3.06E-03 -6.88E-03
Aortic stenosis BB70 Calcified aortic valve 9.16E-01 -3.45E-03 -1.04E-02
Apnea 7A40 Hyperplastic tonsil 5.89E-01 4.85E-02 2.57E-01
Arthropathy FA00-FA5Z Peripheral blood 2.22E-01 -6.97E-03 -4.73E-02
Asthma CA23 Nasal and bronchial airway 7.94E-01 -8.21E-02 -1.35E-01
Atopic dermatitis EA80 Skin 9.89E-01 1.15E-02 4.69E-02
Autism 6A02 Whole blood 9.73E-01 -8.87E-02 -3.96E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.41E-01 3.04E-01 1.41E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.17E-01 6.84E-01 2.68E+00
Bacterial infection of gingival 1C1H Gingival tissue 4.80E-01 5.36E-03 2.52E-02
Batten disease 5C56.1 Whole blood 4.48E-01 2.00E-02 2.54E-01
Behcet's disease 4A62 Peripheral blood 4.75E-01 1.00E-01 6.20E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.40E-01 -4.08E-02 -1.59E-01
Bladder cancer 2C94 Bladder tissue 1.65E-01 -2.95E-01 -8.08E-01
Breast cancer 2C60-2C6Z Breast tissue 7.30E-11 -3.21E-01 -6.14E-01
Cardioembolic stroke 8B11.20 Whole blood 2.11E-05 4.37E-01 1.37E+00
Cervical cancer 2C77 Cervical tissue 2.62E-01 5.39E-02 2.74E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 9.84E-01 2.01E-01 4.29E-01
Chronic hepatitis C 1E51.1 Whole blood 7.68E-01 4.58E-02 2.39E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 4.82E-01 8.57E-03 3.88E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.54E-02 -5.21E-02 -1.77E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.53E-01 -1.75E-01 -7.68E-01
Colon cancer 2B90 Colon tissue 2.17E-03 6.18E-03 2.91E-02
Coronary artery disease BA80-BA8Z Peripheral blood 4.20E-01 -8.45E-03 -6.66E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.92E-01 -1.24E-01 -2.33E-01
Endometriosis GA10 Endometrium tissue 1.32E-01 1.30E-01 3.96E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.56E-02 -8.63E-02 -9.99E-01
Familial hypercholesterolemia 5C80.00 Whole blood 9.03E-02 -9.32E-02 -5.35E-01
Gastric cancer 2B72 Gastric tissue 9.07E-01 2.18E-01 2.93E-01
Glioblastopma 2A00.00 Nervous tissue 2.23E-85 -1.13E+00 -1.56E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.29E-01 3.07E-01 5.67E-01
Head and neck cancer 2D42 Head and neck tissue 1.41E-01 1.29E-01 3.09E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.47E-02 -9.21E-02 -4.03E-01
Huntington's disease 8A01.10 Whole blood 1.02E-01 -1.13E-02 -1.12E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.32E-01 -8.52E-02 -3.61E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.42E-01 -1.38E-02 -8.82E-02
Influenza 1.00E+30 Whole blood 1.75E-02 -5.21E-01 -3.48E+00
Interstitial cystitis GC00.3 Bladder tissue 4.70E-01 -2.19E-01 -6.78E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.97E-03 5.65E-01 2.83E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.52E-01 3.29E-02 1.50E-01
Ischemic stroke 8B11 Peripheral blood 6.30E-01 -1.66E-02 -9.13E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 2.16E-01 -9.63E-02 -3.17E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 7.17E-02 7.11E-02 4.52E-01
Lateral sclerosis 8B60.4 Skin 6.56E-01 3.41E-02 2.39E-01
Liver cancer 2C12.0 Liver tissue 6.98E-09 -6.90E-01 -1.20E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.86E-01 -1.88E-01 -2.18E-01
Lung cancer 2C25 Lung tissue 3.86E-03 3.51E-02 9.06E-02
Lupus erythematosus 4A40 Whole blood 8.65E-01 2.59E-02 7.52E-02
Major depressive disorder 6A70-6A7Z Whole blood 2.10E-01 6.35E-02 2.52E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.57E-01 -7.16E-03 -2.80E-02
Melanoma 2C30 Skin 4.27E-03 6.24E-01 7.80E-01
Multiple myeloma 2A83.1 Bone marrow 1.18E-01 1.87E-01 7.59E-01
Multiple myeloma 2A83.1 Peripheral blood 4.27E-01 -3.65E-02 -2.85E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.74E-01 8.80E-02 3.68E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.34E-01 -5.96E-02 -2.80E-01
Myelofibrosis 2A20.2 Whole blood 1.51E-01 -5.64E-02 -5.74E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.60E-02 1.98E-01 4.19E-01
Myopathy 8C70.6 Muscle tissue 2.34E-02 1.20E-01 1.06E+00
Neonatal sepsis KA60 Whole blood 4.81E-02 4.99E-02 2.69E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.92E-06 -2.05E+00 -3.18E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 4.00E-01 2.73E-01 6.01E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.08E-01 -9.61E-02 -1.13E+00
Olive pollen allergy CA08.00 Peripheral blood 3.72E-01 5.21E-01 1.05E+00
Oral cancer 2B6E Oral tissue 2.40E-02 2.13E-01 4.55E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.29E-01 3.79E-01 8.37E-01
Osteoporosis FB83.1 Bone marrow 1.65E-01 3.83E-01 1.66E+00
Ovarian cancer 2C73 Ovarian tissue 4.56E-02 -3.42E-01 -2.35E-01
Pancreatic cancer 2C10 Pancreas 6.82E-02 -3.71E-01 -1.08E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 9.05E-03 -6.00E-01 -2.08E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 5.02E-01 5.43E-02 3.76E-01
Pituitary cancer 2D12 Pituitary tissue 1.50E-03 1.16E+00 1.70E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.78E-06 1.34E+00 3.41E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.76E-01 -2.61E-02 -1.69E-01
Polycythemia vera 2A20.4 Whole blood 6.93E-02 -3.53E-02 -2.84E-01
Pompe disease 5C51.3 Biceps muscle 1.60E-01 -6.19E-02 -4.54E-01
Preterm birth KA21.4Z Myometrium 3.64E-01 1.48E-01 1.47E+00
Prostate cancer 2C82 Prostate 1.02E-01 2.48E-01 3.34E-01
Psoriasis EA90 Skin 5.07E-48 1.26E+00 3.52E+00
Rectal cancer 2B92 Rectal colon tissue 1.19E-01 1.93E-01 7.50E-01
Renal cancer 2C90-2C91 Kidney 3.05E-01 4.42E-02 6.47E-02
Retinoblastoma 2D02.2 Uvea 5.04E-14 -2.02E+00 -9.61E+00
Rheumatoid arthritis FA20 Synovial tissue 9.32E-04 6.15E-01 2.31E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.38E-02 -1.05E-01 -3.65E-01
Schizophrenia 6A20 Prefrontal cortex 2.28E-03 -2.27E-01 -4.51E-01
Schizophrenia 6A20 Superior temporal cortex 8.69E-01 2.74E-02 9.43E-02
Scleroderma 4A42.Z Whole blood 4.60E-01 1.99E-02 1.06E-01
Seizure 8A60-8A6Z Whole blood 8.69E-01 3.40E-02 1.36E-01
Sensitive skin EK0Z Skin 2.11E-01 1.40E-01 1.16E+00
Sepsis with septic shock 1G41 Whole blood 2.67E-04 6.12E-02 3.21E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.43E-02 1.26E-01 9.40E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 6.24E-01 -3.56E-02 -3.05E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 9.57E-01 6.77E-02 3.56E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.83E-01 -2.04E-01 -1.04E+00
Skin cancer 2C30-2C3Z Skin 1.85E-58 7.16E-01 2.12E+00
Thrombocythemia 3B63 Whole blood 9.39E-01 -5.36E-02 -5.12E-01
Thrombocytopenia 3B64 Whole blood 2.22E-02 -2.11E-01 -6.24E-01
Thyroid cancer 2D10 Thyroid 1.32E-08 -3.29E-01 -7.90E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.50E-02 -8.37E-02 -7.23E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.12E-01 -3.66E-01 -4.91E-01
Type 2 diabetes 5A11 Liver tissue 1.64E-01 -5.42E-01 -5.75E-01
Ureter cancer 2C92 Urothelium 5.00E-02 1.08E-01 1.08E+00
Uterine cancer 2C78 Endometrium tissue 2.64E-07 1.36E-01 4.76E-01
Vitiligo ED63.0 Skin 2.59E-01 -9.37E-02 -5.50E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Solute carrier family 23 member 2 (SLC23A2) DTT Info
DTP DTT Type Successful
Related Disease
Autoimmune liver disease [ICD-11: DB96]
Vitamin deficiency [ICD-11: 5B55-5B5F]
2 Approved Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ursodeoxycholic acid DMCUT21 Primary biliary cirrhosis DB96.1 Approved [1], [2]
Vitamin C DMXJ7O8 Vitamin C deficiency 5B56 Approved [3]
------------------------------------------------------------------------------------

References

1 Role of vitamin C transporters and biliverdin reductase in the dual pro-oxidant and anti-oxidant effect of biliary compounds on the placental-fetal... Toxicol Appl Pharmacol. 2008 Oct 15;232(2):327-36.
2 Influence of ursodeoxycholic acid on the mortality and malignancy associated with primary biliary cirrhosis: a population-based cohort study. Hepatology. 2007 Oct;46(4):1131-7.
3 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1042).
4 Molecular characterization and transcriptional regulation of the sodium-dependent vitamin C transporter genes (slc23a1 and slc23a2) in a teleost fish, the Senegalese sole (Solea senegalensis). Comp Biochem Physiol B Biochem Mol Biol. 2012 Mar;161(3):208-18.