Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTX8KP0)

DTP Name Sodium- and chloride-dependent GABA transporter 2 (SLC6A13)
Gene Name SLC6A13
UniProt ID
Q9NSD5 (S6A13_HUMAN)
VARIDT ID
DTD0445
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms GAT-2; GAT2; SLC6A13; Solute carrier family 6 member 13
DTP Family Neurotransmitter:Sodium Symporter (NSS) Family ;
Tissue Specificity Expressed in brain, kidney, lung, liver andtestis.
Sequence
MDSRVSGTTSNGETKPVYPVMEKKEEDGTLERGHWNNKMEFVLSVAGEIIGLGNVWRFPY
LCYKNGGGAFFIPYLVFLFTCGIPVFLLETALGQYTSQGGVTAWRKICPIFEGIGYASQM
IVILLNVYYIIVLAWALFYLFSSFTIDLPWGGCYHEWNTEHCMEFQKTNGSLNGTSENAT
SPVIEFWERRVLKISDGIQHLGALRWELALCLLLAWVICYFCIWKGVKSTGKVVYFTATF
PYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLWDPQVWMDAGTQIFFSFAICLGCLTAL
GSYNKYHNNCYRDCIALCFLNSGTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFI
AYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPHVFRKKNRREVLI
LGVSVVSFLVGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGAKRFYDNI
EDMIGYRPWPLIKYCWLFLTPAVCTATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALS
SMVCIPAWSLYRLGTLKGPFRERIRQLMCPAEDLPQRNPAGPSAPATPRTSLLRLTELES
HC
Function This sodium-dependent transporter is for GABA and taurine and may also be involved in beta-alanine transport. In presynaptic terminals, regulates GABA signaling termination through GABA uptake.
Endogenous Substrate(s) Cl-; Gamma-aminobutyric acid; Na+
TCDB ID
2.A.22.3.10
Gene ID
6540
KEGG Pathway
Synaptic vesicle cycle (hsa04721 )
GABAergic synapse (hsa04727 )
Reactome Pathway
Reuptake of GABA (R-HSA-888593 )
Na+/Cl- dependent neurotransmitter transporters (R-HSA-442660 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Beta-Alanine DMC64EI Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.42E-02 3.40E-02 1.89E-01
Adrenocortical carcinoma 2D11.Z Kidney 2.68E-02 9.06E-02 4.47E-01
Alopecia ED70 Skin from scalp 3.44E-01 9.87E-03 3.30E-02
Alzheimer's disease 8A20 Entorhinal cortex 2.37E-01 1.88E-02 4.96E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 3.82E-01 -1.05E-02 -7.58E-02
Aortic stenosis BB70 Calcified aortic valve 7.19E-01 1.40E-01 1.70E-01
Apnea 7A40 Hyperplastic tonsil 3.35E-01 -3.52E-01 -1.31E+00
Arthropathy FA00-FA5Z Peripheral blood 8.84E-01 -4.56E-03 -3.22E-02
Asthma CA23 Nasal and bronchial airway 8.74E-07 -5.76E-01 -7.31E-01
Atopic dermatitis EA80 Skin 5.30E-01 9.98E-02 4.73E-01
Autism 6A02 Whole blood 5.40E-02 -5.40E-02 -2.07E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.12E-01 -1.74E-02 -1.77E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.35E-02 -1.34E-01 -2.20E+00
Bacterial infection of gingival 1C1H Gingival tissue 4.91E-08 2.09E-01 7.30E-01
Batten disease 5C56.1 Whole blood 7.51E-02 2.16E-01 6.74E-01
Behcet's disease 4A62 Peripheral blood 2.85E-01 1.22E-01 7.86E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.35E-02 4.67E-02 2.92E-01
Bladder cancer 2C94 Bladder tissue 3.50E-05 4.17E-01 2.97E+00
Breast cancer 2C60-2C6Z Breast tissue 5.08E-12 -1.39E-01 -4.74E-01
Cardioembolic stroke 8B11.20 Whole blood 1.38E-03 3.21E-01 8.70E-01
Cervical cancer 2C77 Cervical tissue 8.60E-01 1.91E-02 5.92E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.87E-01 -6.68E-02 -3.10E-01
Chronic hepatitis C 1E51.1 Whole blood 9.20E-02 -9.82E-02 -5.51E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 9.80E-02 7.79E-02 3.84E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.61E-02 -2.90E-01 -5.24E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.13E-02 -9.82E-02 -1.15E-01
Colon cancer 2B90 Colon tissue 2.71E-08 -9.72E-02 -5.10E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.38E-01 -4.58E-01 -8.15E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.09E-01 -5.65E-01 -8.41E-01
Endometriosis GA10 Endometrium tissue 2.86E-01 2.73E-01 8.52E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.97E-01 5.17E-03 5.09E-02
Familial hypercholesterolemia 5C80.00 Whole blood 9.98E-06 -3.29E-01 -1.09E+00
Gastric cancer 2B72 Gastric tissue 7.04E-02 -1.95E-01 -1.79E+00
Glioblastopma 2A00.00 Nervous tissue 1.04E-48 -8.11E-01 -1.49E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.42E-01 2.16E-01 7.00E-01
Head and neck cancer 2D42 Head and neck tissue 4.64E-08 -1.79E-01 -2.16E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.14E-01 -1.48E-02 -5.29E-02
Huntington's disease 8A01.10 Whole blood 6.63E-01 1.29E-02 1.24E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 4.00E-01 7.53E-02 7.05E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.14E-01 1.29E-01 1.03E+00
Influenza 1.00E+30 Whole blood 1.59E-03 3.96E-01 5.33E+00
Interstitial cystitis GC00.3 Bladder tissue 5.78E-02 1.95E-01 1.75E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.09E-03 1.46E+00 3.50E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 5.80E-03 5.02E-02 2.28E-01
Ischemic stroke 8B11 Peripheral blood 5.53E-02 4.42E-02 4.51E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 7.76E-01 4.82E-03 2.06E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 4.27E-02 -3.91E-01 -7.21E-01
Lateral sclerosis 8B60.4 Skin 1.75E-01 6.96E-02 5.21E-01
Liver cancer 2C12.0 Liver tissue 6.41E-06 -5.79E-01 -1.47E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.02E-03 -4.68E-01 -1.89E+00
Lung cancer 2C25 Lung tissue 6.97E-47 -5.74E-01 -1.57E+00
Lupus erythematosus 4A40 Whole blood 1.74E-02 -1.08E-01 -1.85E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.70E-01 1.48E-01 5.11E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.97E-01 9.18E-02 5.76E-01
Melanoma 2C30 Skin 5.45E-01 3.60E-01 5.26E-01
Multiple myeloma 2A83.1 Bone marrow 9.97E-04 -6.07E-01 -1.76E+00
Multiple myeloma 2A83.1 Peripheral blood 2.80E-01 3.30E-02 2.43E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.64E-01 2.21E-01 5.34E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.65E-01 3.97E-02 1.60E-01
Myelofibrosis 2A20.2 Whole blood 5.08E-03 1.05E-01 6.17E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.96E-01 2.78E-02 3.76E-02
Myopathy 8C70.6 Muscle tissue 1.24E-01 -9.66E-02 -1.00E+00
Neonatal sepsis KA60 Whole blood 7.11E-01 -2.63E-02 -1.22E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.14E-06 -1.88E+00 -3.04E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.47E-01 -4.10E-02 -1.41E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.15E-01 -6.20E-02 -2.28E-01
Olive pollen allergy CA08.00 Peripheral blood 6.55E-01 4.99E-02 4.87E-02
Oral cancer 2B6E Oral tissue 8.36E-02 -3.01E-01 -1.02E+00
Osteoarthritis FA00-FA0Z Synovial tissue 9.81E-01 1.08E-02 8.89E-02
Osteoporosis FB83.1 Bone marrow 7.98E-01 9.16E-02 4.77E-01
Ovarian cancer 2C73 Ovarian tissue 2.05E-03 5.74E-01 1.12E+00
Pancreatic cancer 2C10 Pancreas 4.19E-02 -2.19E-01 -5.34E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.13E-01 -1.24E-01 -3.06E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.70E-02 1.15E-01 1.03E+00
Pituitary cancer 2D12 Pituitary tissue 8.58E-01 1.83E-01 2.94E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.81E-01 9.55E-02 1.34E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.75E-01 2.30E-03 2.67E-02
Polycythemia vera 2A20.4 Whole blood 6.08E-03 9.29E-02 5.31E-01
Pompe disease 5C51.3 Biceps muscle 5.58E-01 -5.89E-02 -4.75E-01
Preterm birth KA21.4Z Myometrium 7.28E-01 -6.75E-02 -4.78E-01
Prostate cancer 2C82 Prostate 9.86E-03 -3.52E-01 -4.53E-01
Psoriasis EA90 Skin 1.11E-11 -1.75E-01 -6.01E-01
Rectal cancer 2B92 Rectal colon tissue 2.38E-02 -2.78E-01 -1.37E+00
Renal cancer 2C90-2C91 Kidney 1.06E-03 -1.27E+00 -1.43E+00
Retinoblastoma 2D02.2 Uvea 3.70E-03 -5.01E-01 -1.19E+00
Rheumatoid arthritis FA20 Synovial tissue 6.53E-03 -3.21E-01 -1.97E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.35E-01 -3.73E-02 -1.29E-01
Schizophrenia 6A20 Prefrontal cortex 1.51E-01 -9.72E-02 -1.14E-01
Schizophrenia 6A20 Superior temporal cortex 9.47E-01 -3.05E-03 -2.54E-02
Scleroderma 4A42.Z Whole blood 3.14E-01 -8.19E-02 -5.24E-01
Seizure 8A60-8A6Z Whole blood 3.63E-01 -6.38E-02 -3.39E-01
Sensitive skin EK0Z Skin 5.11E-01 1.63E-02 1.45E-01
Sepsis with septic shock 1G41 Whole blood 2.36E-02 4.63E-02 2.09E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.14E-02 3.86E-01 1.12E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.06E-02 1.20E-01 6.78E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.12E-01 5.30E-02 8.93E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 9.59E-01 6.99E-02 3.24E-01
Skin cancer 2C30-2C3Z Skin 1.14E-01 -1.50E-01 -3.79E-01
Thrombocythemia 3B63 Whole blood 7.67E-03 2.08E-01 1.26E+00
Thrombocytopenia 3B64 Whole blood 7.85E-01 4.93E-02 3.79E-01
Thyroid cancer 2D10 Thyroid 4.90E-28 -7.84E-01 -1.84E+00
Tibial muscular dystrophy 8C75 Muscle tissue 4.73E-01 -9.17E-03 -5.33E-02
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.46E-01 -2.53E-01 -3.68E+00
Type 2 diabetes 5A11 Liver tissue 1.60E-02 -2.08E-01 -1.61E+00
Ureter cancer 2C92 Urothelium 3.06E-01 -1.18E-01 -3.61E-01
Uterine cancer 2C78 Endometrium tissue 2.24E-10 2.24E-01 6.27E-01
Vitiligo ED63.0 Skin 1.52E-01 -1.49E-01 -5.18E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

References

1 Astrocytic -aminobutyric acid (GABA) transporters mediate guanidinoacetate transport in rat brain. 2018 Feb;113:1-7.