Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTXBIQG)

DTP Name Sodium- and chloride-dependent GABA transporter 3 (SLC6A11)
Gene Name SLC6A11
UniProt ID
P48066 (S6A11_HUMAN)
VARIDT ID
DTD0443
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms GABT3; GAT-3; GAT3; GAT4; SLC6A11; Solute carrier family 6 member 11
DTP Family Neurotransmitter:Sodium Symporter (NSS) Family ;
Tissue Specificity Widespread distribution in the brain.
Sequence
MTAEKALPLGNGKAAEEARESEAPGGGCSSGGAAPARHPRVKRDKAVHERGHWNNKVEFV
LSVAGEIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGIT
CWRKVCPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTENC
VEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLRWELALCLLAAWTICY
FCIWKGTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQVWV
DAGTQIFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMA
YEQGVPIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVT
AVVDMYPKVFRRGYRRELLILALSVISYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVA
IFECICIGWVYGSNRFYDNIEDMIGYRPPSLIKWCWMIMTPGICAGIFIFFLIKYKPLKY
NNIYTYPAWGYGIGWLMALSSMLCIPLWICITVWKTEGTLPEKLQKLTTPSTDLKMRGKL
GVSPRMVTVNDCDAKLKSDGTIAAITEKETHF
Function This transporter terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.
Endogenous Substrate(s) Cl-; Gamma-butyric acid; Na+
TCDB ID
2.A.22.3.9
Gene ID
6538
KEGG Pathway
Synaptic vesicle cycle (hsa04721 )
GABAergic synapse (hsa04727 )
Reactome Pathway
Creatine metabolism (R-HSA-71288 )
Reuptake of GABA (R-HSA-888593 )
Na+/Cl- dependent neurotransmitter transporters (R-HSA-442660 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Beta-Alanine DMC64EI Discovery agent N.A. Investigative [2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.02E-04 1.16E-01 6.26E-01
Adrenocortical carcinoma 2D11.Z Kidney 7.54E-01 2.80E-02 1.19E-01
Alopecia ED70 Skin from scalp 3.69E-02 -1.17E-01 -2.82E-01
Alzheimer's disease 8A20 Entorhinal cortex 8.24E-01 1.81E-02 4.48E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 3.37E-01 5.12E-02 3.61E-01
Aortic stenosis BB70 Calcified aortic valve 7.73E-01 -2.78E-02 -1.44E-01
Apnea 7A40 Hyperplastic tonsil 6.39E-01 -3.82E-02 -1.55E-01
Arthropathy FA00-FA5Z Peripheral blood 6.42E-02 8.85E-02 9.78E-01
Asthma CA23 Nasal and bronchial airway 5.14E-01 3.46E-02 1.03E-01
Atopic dermatitis EA80 Skin 1.46E-03 2.09E-01 8.93E-01
Autism 6A02 Whole blood 8.76E-02 -1.94E-02 -1.03E-01
Autoimmune uveitis 9A96 Peripheral monocyte 5.20E-02 -2.26E-01 -2.40E+00
Autosomal dominant monocytopenia 4B04 Whole blood 1.13E-01 -1.77E-02 -1.32E-01
Bacterial infection of gingival 1C1H Gingival tissue 2.31E-02 -4.82E-02 -1.52E-01
Batten disease 5C56.1 Whole blood 9.38E-01 2.99E-03 3.64E-02
Behcet's disease 4A62 Peripheral blood 8.03E-01 -5.61E-02 -2.53E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.60E-01 1.65E-02 1.18E-01
Bladder cancer 2C94 Bladder tissue 4.49E-02 1.31E-01 7.80E-01
Breast cancer 2C60-2C6Z Breast tissue 6.07E-01 -3.05E-02 -1.34E-01
Cardioembolic stroke 8B11.20 Whole blood 5.55E-01 -6.33E-02 -2.66E-01
Cervical cancer 2C77 Cervical tissue 2.33E-01 -7.86E-02 -3.95E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.84E-01 -4.30E-02 -1.78E-01
Chronic hepatitis C 1E51.1 Whole blood 1.58E-01 1.46E-01 1.12E+00
Chronic obstructive pulmonary disease CA22 Lung tissue 4.23E-01 -2.10E-02 -9.06E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 6.90E-06 2.08E-01 9.61E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.33E-01 1.26E-02 9.06E-02
Colon cancer 2B90 Colon tissue 1.89E-04 -8.72E-02 -3.45E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.64E-01 -1.25E-01 -6.30E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.30E-01 -3.25E-02 -2.67E-01
Endometriosis GA10 Endometrium tissue 4.15E-01 -6.79E-02 -2.28E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.68E-01 6.68E-05 5.71E-04
Familial hypercholesterolemia 5C80.00 Whole blood 4.90E-01 3.63E-02 1.65E-01
Gastric cancer 2B72 Gastric tissue 2.58E-02 -3.09E-01 -3.24E+00
Glioblastopma 2A00.00 Nervous tissue 1.92E-34 -4.60E-01 -8.96E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.34E-03 -7.66E-01 -1.12E+00
Head and neck cancer 2D42 Head and neck tissue 7.80E-06 3.08E-01 7.56E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 8.62E-01 -6.23E-02 -2.29E-01
Huntington's disease 8A01.10 Whole blood 6.68E-01 8.57E-02 4.09E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.00E-01 -4.09E-02 -4.24E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.29E-01 8.57E-02 6.56E-01
Influenza 1.00E+30 Whole blood 6.05E-02 2.51E-01 2.34E+00
Interstitial cystitis GC00.3 Bladder tissue 8.32E-01 -3.43E-02 -6.21E-01
Intracranial aneurysm 8B01.0 Intracranial artery 2.54E-01 -8.52E-02 -4.29E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 2.11E-01 9.66E-02 3.07E-01
Ischemic stroke 8B11 Peripheral blood 9.18E-01 1.47E-02 9.38E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.64E-01 1.49E-01 3.06E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.70E-01 -1.02E-01 -4.40E-01
Lateral sclerosis 8B60.4 Skin 1.09E-01 -1.47E-01 -1.98E+00
Liver cancer 2C12.0 Liver tissue 3.84E-03 2.26E-02 8.20E-02
Liver failure DB99.7-DB99.8 Liver tissue 4.79E-01 1.17E-01 7.06E-01
Lung cancer 2C25 Lung tissue 4.70E-02 4.71E-02 2.01E-01
Lupus erythematosus 4A40 Whole blood 8.99E-01 2.01E-02 5.26E-02
Major depressive disorder 6A70-6A7Z Whole blood 8.93E-03 4.41E-02 2.91E-01
Major depressive disorder 6A70-6A7Z Hippocampus 1.29E-01 -2.69E-02 -1.84E-01
Melanoma 2C30 Skin 6.83E-03 -2.57E-01 -8.38E-01
Multiple myeloma 2A83.1 Bone marrow 2.93E-01 7.17E-02 3.71E-01
Multiple myeloma 2A83.1 Peripheral blood 6.60E-01 6.01E-02 3.75E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.52E-01 3.01E-01 1.37E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.06E-01 -1.22E-03 -7.15E-03
Myelofibrosis 2A20.2 Whole blood 7.49E-01 2.10E-03 1.60E-02
Myocardial infarction BA41-BA50 Peripheral blood 9.91E-01 -3.27E-03 -5.30E-03
Myopathy 8C70.6 Muscle tissue 2.41E-01 -6.36E-02 -4.78E-01
Neonatal sepsis KA60 Whole blood 1.11E-02 7.70E-02 3.34E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.20E-02 -7.10E-02 -2.72E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 9.81E-01 -7.98E-02 -4.42E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.44E-02 1.19E-01 2.06E+00
Olive pollen allergy CA08.00 Peripheral blood 4.36E-01 1.11E-01 9.83E-01
Oral cancer 2B6E Oral tissue 7.27E-04 -3.15E-01 -8.70E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.47E-01 -6.30E-02 -1.68E-01
Osteoporosis FB83.1 Bone marrow 6.99E-01 3.16E-02 2.74E-01
Ovarian cancer 2C73 Ovarian tissue 1.50E-01 1.34E-01 6.46E-01
Pancreatic cancer 2C10 Pancreas 2.32E-03 -1.90E-01 -1.11E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 1.04E-01 -3.45E-01 -1.05E+00
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.81E-01 -1.19E-02 -8.13E-02
Pituitary cancer 2D12 Pituitary tissue 7.34E-02 8.90E-02 4.56E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.68E-01 7.22E-02 3.12E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 8.34E-01 -1.95E-02 -5.44E-02
Polycythemia vera 2A20.4 Whole blood 7.20E-05 5.33E-02 3.69E-01
Pompe disease 5C51.3 Biceps muscle 2.32E-01 -4.10E-02 -2.74E-01
Preterm birth KA21.4Z Myometrium 6.21E-01 1.60E-02 1.06E-01
Prostate cancer 2C82 Prostate 1.45E-10 8.89E-01 2.45E+00
Psoriasis EA90 Skin 8.65E-24 5.37E-01 1.54E+00
Rectal cancer 2B92 Rectal colon tissue 3.15E-02 -1.36E-01 -9.19E-01
Renal cancer 2C90-2C91 Kidney 3.01E-03 -5.65E-01 -1.54E+00
Retinoblastoma 2D02.2 Uvea 7.65E-04 -4.57E-01 -1.48E+00
Rheumatoid arthritis FA20 Synovial tissue 2.96E-02 -3.36E-01 -9.12E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.98E-01 3.43E-03 3.43E-02
Schizophrenia 6A20 Prefrontal cortex 8.03E-01 -4.19E-03 -1.64E-02
Schizophrenia 6A20 Superior temporal cortex 5.39E-01 8.87E-04 5.33E-03
Scleroderma 4A42.Z Whole blood 5.08E-02 6.81E-02 5.33E-01
Seizure 8A60-8A6Z Whole blood 7.73E-01 -2.76E-02 -1.32E-01
Sensitive skin EK0Z Skin 6.97E-01 7.94E-02 5.07E-01
Sepsis with septic shock 1G41 Whole blood 6.45E-02 3.21E-03 1.31E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.01E-01 -9.82E-02 -5.20E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.60E-01 2.74E-01 8.95E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.01E-01 7.02E-02 3.71E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.94E-01 9.45E-02 2.79E-01
Skin cancer 2C30-2C3Z Skin 2.64E-18 -5.78E-01 -1.36E+00
Thrombocythemia 3B63 Whole blood 5.00E-02 3.62E-02 2.93E-01
Thrombocytopenia 3B64 Whole blood 4.11E-01 1.41E-02 7.88E-02
Thyroid cancer 2D10 Thyroid 1.53E-05 5.25E-02 3.01E-01
Tibial muscular dystrophy 8C75 Muscle tissue 2.65E-04 -2.86E-01 -1.09E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.38E-01 -1.57E-04 -6.45E-04
Type 2 diabetes 5A11 Liver tissue 1.33E-01 -2.80E-01 -1.21E+00
Ureter cancer 2C92 Urothelium 9.07E-01 9.96E-03 5.82E-02
Uterine cancer 2C78 Endometrium tissue 6.86E-11 3.09E-01 7.94E-01
Vitiligo ED63.0 Skin 1.37E-01 2.11E-01 1.00E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Gamma-aminobutyric acid transporter 4 (SLC6A11) DTT Info
DTP DTT Type Literature-reported
1 Investigative Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
SNAP-5114 DMFM19S Discovery agent N.A. Investigative [1]
------------------------------------------------------------------------------------

References

1 GABA-level increasing and anticonvulsant effects of three different GABA uptake inhibitors. Neuropharmacology. 2000 Sep;39(12):2399-407.
2 Astrocytic -aminobutyric acid (GABA) transporters mediate guanidinoacetate transport in rat brain. 2018 Feb;113:1-7.