Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTXC0W6)

DTP Name Adenosine 3'-phospho 5'-phosphosulfate transporter 2 (SLC35B3)
Gene Name SLC35B3
UniProt ID
Q9H1N7 (S35B3_HUMAN)
VARIDT ID
DTD0294
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms 3'-phosphoadenosine 5'-phosphosulfate transporter; C6orf196; CGI-19; PAPS transporter 2; PAPST2; SLC35B3; Solute carrier family 35 member B3
DTP Family Drug/Metabolite Transporter (DMT) Superfamily
UDP-Galactose:UMP Antiporter (UGA) Family
Tissue Specificity Preferentially and highly expressed in colon.
Sequence
MDLTQQAKDIQNITVQETNKNNSESIECSKITMDLKFNNSRKYISITVPSKTQTMSPHIK
SVDDVVVLGMNLSKFNKLTQFFICVAGVFVFYLIYGYLQELIFSVEGFKSCGWYLTLVQF
AFYSIFGLIELQLIQDKRRRIPGKTYMIIAFLTVGTMGLSNTSLGYLNYPTQVIFKCCKL
IPVMLGGVFIQGKRYNVADVSAAICMSLGLIWFTLADSTTAPNFNLTGVVLISLALCADA
VIGNVQEKAMKLHNASNSEMVLYSYSIGFVYILLGLTCTSGLGPAVTFCAKNPVRTYGYA
FLFSLTGYFGISFVLALIKIFGALIAVTVTTGRKAMTIVLSFIFFAKPFTFQYVWSGLLV
VLGIFLNVYSKNMDKIRLPSLYDLINKSVEARKSRTLAQTV
Function This transporter mediates the transport of adenosine 3'- phosphate 6'- phosphate sulfate (PAPS) from cytoplasm to Golgi apparatus.
Endogenous Substrate(s) Adenosine 3'-phosphate 5'-phosphosulfate
TCDB ID
2.A.7.11.5
Gene ID
51000
Reactome Pathway
Transport of nucleotide sugars (R-HSA-727802 )
Transport and synthesis of PAPS (R-HSA-174362 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.67E-05 -3.97E-01 -6.16E-01
Adrenocortical carcinoma 2D11.Z Kidney 8.08E-02 1.29E-03 3.88E-03
Alopecia ED70 Skin from scalp 7.95E-05 2.09E-01 8.01E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.89E-02 7.37E-02 3.09E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.48E-01 -2.47E-02 -2.08E-01
Aortic stenosis BB70 Calcified aortic valve 8.55E-01 8.86E-02 8.14E-02
Apnea 7A40 Hyperplastic tonsil 2.68E-01 3.20E-01 8.32E-01
Arthropathy FA00-FA5Z Peripheral blood 7.23E-01 -4.51E-02 -1.72E-01
Asthma CA23 Nasal and bronchial airway 3.01E-09 7.43E-01 9.79E-01
Atopic dermatitis EA80 Skin 3.05E-01 -8.87E-02 -3.86E-01
Autism 6A02 Whole blood 5.86E-02 1.61E-01 5.26E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.35E-01 4.39E-01 9.47E-01
Autosomal dominant monocytopenia 4B04 Whole blood 1.52E-01 -7.35E-01 -1.18E+00
Bacterial infection of gingival 1C1H Gingival tissue 6.61E-01 4.34E-03 1.73E-02
Batten disease 5C56.1 Whole blood 3.28E-01 -1.56E-02 -1.25E-01
Behcet's disease 4A62 Peripheral blood 7.95E-01 -3.28E-02 -1.28E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 4.53E-01 3.66E-02 3.47E-01
Bladder cancer 2C94 Bladder tissue 2.46E-01 1.04E-01 5.97E-01
Breast cancer 2C60-2C6Z Breast tissue 6.75E-12 2.52E-01 5.26E-01
Cardioembolic stroke 8B11.20 Whole blood 2.87E-01 -1.17E-01 -3.73E-01
Cervical cancer 2C77 Cervical tissue 1.59E-02 1.67E-01 6.93E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.92E-01 -4.15E-02 -1.77E-01
Chronic hepatitis C 1E51.1 Whole blood 5.45E-01 -2.53E-01 -6.50E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.81E-01 -4.88E-02 -2.73E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.64E-01 1.06E-01 4.30E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.34E-01 1.06E-01 1.16E+00
Colon cancer 2B90 Colon tissue 2.69E-27 -3.96E-01 -1.30E+00
Coronary artery disease BA80-BA8Z Peripheral blood 2.39E-01 9.08E-01 8.33E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 4.95E-01 1.10E-01 1.56E-01
Endometriosis GA10 Endometrium tissue 1.91E-02 -2.22E-01 -6.11E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.89E-01 2.60E-02 2.06E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.20E-07 5.71E-01 1.40E+00
Gastric cancer 2B72 Gastric tissue 5.97E-01 5.13E-02 5.28E-02
Glioblastopma 2A00.00 Nervous tissue 3.83E-64 4.38E-01 1.29E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.17E-01 -2.66E-01 -5.75E-01
Head and neck cancer 2D42 Head and neck tissue 1.50E-12 -4.25E-01 -8.80E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 9.07E-01 -2.23E-02 -6.85E-02
Huntington's disease 8A01.10 Whole blood 5.83E-01 -1.95E-01 -7.59E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.65E-01 -3.68E-01 -1.04E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.35E-02 -1.14E-01 -1.10E+00
Influenza 1.00E+30 Whole blood 3.89E-02 -6.21E-01 -2.39E+00
Interstitial cystitis GC00.3 Bladder tissue 8.05E-01 7.98E-02 4.96E-01
Intracranial aneurysm 8B01.0 Intracranial artery 5.84E-01 2.02E-01 4.58E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.14E-01 4.27E-02 1.67E-01
Ischemic stroke 8B11 Peripheral blood 9.72E-02 -2.21E-01 -6.61E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.30E-01 -2.70E-02 -4.05E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 7.94E-02 -3.94E-01 -7.95E-01
Lateral sclerosis 8B60.4 Skin 7.60E-01 2.75E-02 1.12E-01
Liver cancer 2C12.0 Liver tissue 5.93E-06 2.76E-01 9.08E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.59E-02 -1.89E-01 -1.08E+00
Lung cancer 2C25 Lung tissue 1.85E-26 3.36E-01 1.25E+00
Lupus erythematosus 4A40 Whole blood 1.66E-05 3.77E-01 6.43E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.68E-01 -1.33E-02 -2.52E-02
Major depressive disorder 6A70-6A7Z Hippocampus 6.69E-01 1.50E-02 1.37E-01
Melanoma 2C30 Skin 3.17E-01 5.06E-03 8.87E-03
Multiple myeloma 2A83.1 Bone marrow 5.36E-03 3.38E-01 1.76E+00
Multiple myeloma 2A83.1 Peripheral blood 5.18E-01 6.16E-02 4.80E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.59E-01 -1.70E-01 -5.57E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.81E-02 5.00E-02 7.64E-02
Myelofibrosis 2A20.2 Whole blood 5.39E-01 2.88E-02 9.96E-02
Myocardial infarction BA41-BA50 Peripheral blood 6.09E-03 -1.96E-01 -2.48E-01
Myopathy 8C70.6 Muscle tissue 2.45E-02 1.30E-01 1.27E+00
Neonatal sepsis KA60 Whole blood 5.00E-07 2.03E-01 4.64E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.54E-03 2.87E-01 8.41E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 8.48E-01 6.88E-02 4.05E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.22E-01 9.94E-03 2.96E-02
Olive pollen allergy CA08.00 Peripheral blood 5.11E-01 -1.81E-01 -1.23E+00
Oral cancer 2B6E Oral tissue 3.17E-06 3.73E-01 7.93E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.99E-01 1.46E-01 3.46E-01
Osteoporosis FB83.1 Bone marrow 6.28E-02 -2.69E-01 -7.83E-01
Ovarian cancer 2C73 Ovarian tissue 5.12E-06 1.10E+00 3.41E+00
Pancreatic cancer 2C10 Pancreas 2.97E-01 1.42E-01 2.93E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.58E-01 7.95E-03 3.24E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 2.12E-01 5.95E-02 2.78E-01
Pituitary cancer 2D12 Pituitary tissue 2.89E-01 -2.62E-01 -6.71E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 3.00E-01 -3.29E-01 -7.98E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.43E-01 3.83E-02 1.87E-01
Polycythemia vera 2A20.4 Whole blood 1.92E-01 1.14E-01 3.95E-01
Pompe disease 5C51.3 Biceps muscle 7.47E-01 3.58E-02 1.34E-01
Preterm birth KA21.4Z Myometrium 5.16E-03 3.65E-01 2.16E+00
Prostate cancer 2C82 Prostate 3.34E-02 6.07E-01 1.37E+00
Psoriasis EA90 Skin 2.22E-01 9.26E-02 3.88E-01
Rectal cancer 2B92 Rectal colon tissue 4.22E-03 -3.33E-01 -1.62E+00
Renal cancer 2C90-2C91 Kidney 3.35E-03 3.50E-01 1.05E+00
Retinoblastoma 2D02.2 Uvea 3.83E-09 1.31E+00 4.63E+00
Rheumatoid arthritis FA20 Synovial tissue 8.40E-01 4.25E-02 9.34E-02
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.70E-01 -2.28E-02 -9.46E-02
Schizophrenia 6A20 Prefrontal cortex 3.56E-01 4.57E-02 1.14E-01
Schizophrenia 6A20 Superior temporal cortex 3.20E-01 4.53E-02 3.24E-01
Scleroderma 4A42.Z Whole blood 6.54E-01 -4.33E-03 -2.19E-02
Seizure 8A60-8A6Z Whole blood 6.06E-01 1.31E-01 4.88E-01
Sensitive skin EK0Z Skin 4.04E-02 -9.40E-02 -1.30E+00
Sepsis with septic shock 1G41 Whole blood 9.97E-01 -1.26E-01 -3.05E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 5.35E-01 -1.02E-01 -1.56E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.39E-03 -7.39E-01 -1.50E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 4.21E-01 -1.13E-01 -3.57E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.20E-01 1.82E-01 7.60E-01
Skin cancer 2C30-2C3Z Skin 2.14E-20 4.67E-01 1.29E+00
Thrombocythemia 3B63 Whole blood 5.59E-01 6.78E-02 2.29E-01
Thrombocytopenia 3B64 Whole blood 5.79E-01 2.38E-02 2.58E-02
Thyroid cancer 2D10 Thyroid 8.52E-26 -5.16E-01 -1.75E+00
Tibial muscular dystrophy 8C75 Muscle tissue 2.61E-05 5.36E-01 1.85E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.37E-01 1.66E-01 1.18E+00
Type 2 diabetes 5A11 Liver tissue 2.14E-01 4.18E-02 3.61E-01
Ureter cancer 2C92 Urothelium 5.84E-01 -4.60E-02 -1.43E-01
Uterine cancer 2C78 Endometrium tissue 8.19E-08 3.04E-01 5.99E-01
Vitiligo ED63.0 Skin 7.26E-01 2.13E-02 1.03E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases