Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTXHKEP)

DTP Name Mitochondrial proton/calcium exchanger protein (SLC55A1)
Gene Name SLC55A1
UniProt ID
O95202 (LETM1_HUMAN)
VARIDT ID
DTD0400
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms LETM1; Leucine zipper-EF-hand-containing transmembrane protein 1; SLC55A1
DTP Family Mitochondrial Inner membrane k(+)/h(+) and ca(2+)/h(+) Exchanger (LETM1) Family ;
Sequence
MASILLRSCRGRAPARLPPPPRYTVPRGSPGDPAHLSCASTLGLRNCLNVPFGCCTPIHP
VYTSSRGDHLGCWALRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRDDSVV
EKSLKSLKDKNKKLEEGGPVYSPPAEVVVKKSLGQRVLDELKHYYHGFRLLWIDTKIAAR
MLWRILNGHSLTRRERRQFLRICADLFRLVPFLVFVVVPFMEFLLPVAVKLFPNMLPSTF
ETQSLKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKGSATKDFSVFFQKIRETGERP
SNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDK
LIAEEGVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLDLHLHQEIPTSLLILSRA
MYLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEQVDNKAKLEATLQEEAAIQQEH
REKELQKRSEVAKDFEPERVVAAPQRPGTEPQPEMPDTVLQSETLKDTAPVLEGLKEEEI
TKEEIDILSDACSKLQEQKKSLTKEKEELELLKEDVQDYSEDLQEIKKELSKTGEEKYVE
ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQV
KHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVAEIVATLEKEEKV
EEKEKAKEKAEKEVAEVKS
Function This transporter is mitochondrial proton/calcium antiporter that mediates proton-dependent calcium efflux from mitochondrion.
Endogenous Substrate(s) Ca2+; Mn2+; Gd3+; La3+; Sr2+; Ba2+; Mg2+; K+; Na+
TCDB ID
2.A.97.1.1
Gene ID
3954
Reactome Pathway
RHOG GTPase cycle (R-HSA-9013408 )
Mitochondrial calcium ion transport (R-HSA-8949215 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 4.04E-10 1.46E-01 7.70E-01
Adrenocortical carcinoma 2D11.Z Kidney 6.14E-01 -1.20E-02 -5.61E-02
Alopecia ED70 Skin from scalp 2.16E-01 8.64E-02 2.21E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.45E-05 -6.42E-02 -4.72E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.35E-01 3.62E-02 2.24E-01
Aortic stenosis BB70 Calcified aortic valve 4.22E-01 1.26E-01 4.73E-01
Apnea 7A40 Hyperplastic tonsil 2.69E-01 -2.56E-01 -9.77E-01
Arthropathy FA00-FA5Z Peripheral blood 4.72E-01 -4.49E-05 -3.43E-04
Asthma CA23 Nasal and bronchial airway 1.82E-02 -8.58E-02 -2.30E-01
Atopic dermatitis EA80 Skin 1.25E-07 3.79E-01 2.77E+00
Autism 6A02 Whole blood 9.73E-01 2.78E-02 1.36E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.56E-01 -9.73E-02 -9.87E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.35E-01 -3.84E-02 -5.27E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.56E-01 3.09E-02 1.40E-01
Batten disease 5C56.1 Whole blood 5.88E-01 4.22E-02 2.94E-01
Behcet's disease 4A62 Peripheral blood 3.00E-01 -6.76E-02 -4.50E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.96E-01 3.28E-02 2.28E-01
Bladder cancer 2C94 Bladder tissue 2.34E-05 3.73E-01 2.56E+00
Breast cancer 2C60-2C6Z Breast tissue 1.16E-35 2.12E-01 8.94E-01
Cardioembolic stroke 8B11.20 Whole blood 9.21E-01 -1.58E-02 -8.30E-02
Cervical cancer 2C77 Cervical tissue 7.13E-04 -2.36E-01 -1.19E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.69E-02 2.29E-02 1.06E-01
Chronic hepatitis C 1E51.1 Whole blood 8.95E-01 -2.06E-03 -2.15E-02
Chronic obstructive pulmonary disease CA22 Lung tissue 9.90E-01 3.43E-02 2.25E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 7.63E-03 1.21E-01 4.96E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 6.05E-01 6.98E-02 4.27E-01
Colon cancer 2B90 Colon tissue 6.28E-45 -4.96E-01 -1.68E+00
Coronary artery disease BA80-BA8Z Peripheral blood 7.96E-01 -1.09E-02 -5.54E-02
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.45E-02 9.08E-02 5.03E-01
Endometriosis GA10 Endometrium tissue 1.46E-01 -5.81E-02 -2.05E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.72E-01 -1.96E-02 -1.08E-01
Familial hypercholesterolemia 5C80.00 Whole blood 8.98E-05 2.42E-01 8.95E-01
Gastric cancer 2B72 Gastric tissue 3.72E-01 1.22E-01 9.10E-01
Glioblastopma 2A00.00 Nervous tissue 3.80E-24 -1.33E-01 -6.24E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.45E-01 6.86E-02 2.53E-01
Head and neck cancer 2D42 Head and neck tissue 1.04E-03 1.89E-01 5.69E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.21E-01 -8.24E-02 -4.16E-01
Huntington's disease 8A01.10 Whole blood 2.43E-01 1.06E-01 6.49E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 6.18E-01 -1.91E-02 -1.30E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.64E-02 1.64E-01 1.67E+00
Influenza 1.00E+30 Whole blood 2.64E-02 -3.53E-01 -2.52E+00
Interstitial cystitis GC00.3 Bladder tissue 9.13E-01 -9.40E-02 -7.06E-01
Intracranial aneurysm 8B01.0 Intracranial artery 9.02E-01 -1.88E-02 -2.37E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.60E-01 -9.33E-03 -2.91E-02
Ischemic stroke 8B11 Peripheral blood 7.59E-01 1.17E-02 7.67E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 3.01E-01 6.37E-02 1.82E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 6.38E-02 1.25E-01 4.11E-01
Lateral sclerosis 8B60.4 Skin 1.49E-01 -6.46E-03 -8.30E-02
Liver cancer 2C12.0 Liver tissue 5.42E-01 4.74E-02 1.98E-01
Liver failure DB99.7-DB99.8 Liver tissue 5.26E-01 4.02E-02 1.05E-01
Lung cancer 2C25 Lung tissue 6.36E-42 2.95E-01 1.32E+00
Lupus erythematosus 4A40 Whole blood 9.15E-02 -9.55E-02 -2.70E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.57E-01 -6.62E-03 -2.49E-02
Major depressive disorder 6A70-6A7Z Hippocampus 8.14E-01 -1.41E-02 -1.05E-01
Melanoma 2C30 Skin 9.74E-03 -3.25E-01 -6.84E-01
Multiple myeloma 2A83.1 Bone marrow 2.86E-06 5.54E-01 4.79E+00
Multiple myeloma 2A83.1 Peripheral blood 7.70E-01 -1.31E-02 -7.37E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 2.50E-01 6.09E-02 2.56E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.57E-01 4.31E-02 1.84E-01
Myelofibrosis 2A20.2 Whole blood 4.96E-01 -1.93E-02 -2.07E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.19E-01 2.45E-01 6.23E-01
Myopathy 8C70.6 Muscle tissue 3.53E-03 -3.68E-01 -1.92E+00
Neonatal sepsis KA60 Whole blood 2.63E-03 -1.26E-01 -4.60E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.93E-01 -1.11E-01 -6.50E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 7.97E-01 -5.15E-03 -2.82E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.55E-01 -7.72E-02 -1.93E-01
Olive pollen allergy CA08.00 Peripheral blood 3.54E-01 1.26E-01 3.92E-01
Oral cancer 2B6E Oral tissue 3.06E-01 2.71E-02 5.95E-02
Osteoarthritis FA00-FA0Z Synovial tissue 2.83E-01 -2.32E-01 -1.01E+00
Osteoporosis FB83.1 Bone marrow 7.28E-01 -4.45E-02 -1.88E-01
Ovarian cancer 2C73 Ovarian tissue 8.52E-01 -5.76E-02 -1.92E-01
Pancreatic cancer 2C10 Pancreas 5.18E-03 -1.89E-01 -6.86E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 3.69E-01 -7.62E-02 -3.53E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.58E-01 4.14E-02 3.34E-01
Pituitary cancer 2D12 Pituitary tissue 1.04E-01 1.37E-01 7.11E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.36E-01 1.03E-01 4.85E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.31E-01 2.04E-02 1.52E-01
Polycythemia vera 2A20.4 Whole blood 1.10E-01 -1.17E-01 -9.20E-01
Pompe disease 5C51.3 Biceps muscle 2.44E-01 -7.12E-02 -2.65E-01
Preterm birth KA21.4Z Myometrium 4.39E-01 -2.18E-01 -5.77E-01
Prostate cancer 2C82 Prostate 5.79E-01 -2.00E-01 -4.75E-01
Psoriasis EA90 Skin 1.16E-02 9.84E-02 3.16E-01
Rectal cancer 2B92 Rectal colon tissue 2.26E-01 -1.42E-01 -3.78E-01
Renal cancer 2C90-2C91 Kidney 1.04E-02 -3.17E-01 -9.25E-01
Retinoblastoma 2D02.2 Uvea 5.77E-01 1.84E-02 7.94E-02
Rheumatoid arthritis FA20 Synovial tissue 5.97E-01 -2.51E-02 -1.59E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.90E-01 -4.45E-02 -2.97E-01
Schizophrenia 6A20 Prefrontal cortex 6.19E-01 -1.59E-02 -8.34E-02
Schizophrenia 6A20 Superior temporal cortex 4.04E-02 -6.34E-02 -7.67E-01
Scleroderma 4A42.Z Whole blood 4.88E-04 2.09E-01 2.17E+00
Seizure 8A60-8A6Z Whole blood 5.17E-01 2.97E-03 1.03E-02
Sensitive skin EK0Z Skin 4.50E-01 2.25E-02 1.43E-01
Sepsis with septic shock 1G41 Whole blood 3.31E-12 -2.11E-01 -7.47E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.83E-04 -3.92E-01 -3.78E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 9.75E-01 -4.36E-03 -1.78E-02
Simpson golabi behmel syndrome LD2C Adipose tissue 4.54E-01 8.94E-02 1.47E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.97E-01 -8.46E-02 -2.08E-01
Skin cancer 2C30-2C3Z Skin 3.51E-02 4.92E-02 1.48E-01
Thrombocythemia 3B63 Whole blood 6.97E-01 -4.04E-03 -3.77E-02
Thrombocytopenia 3B64 Whole blood 9.68E-01 1.43E-01 2.42E-01
Thyroid cancer 2D10 Thyroid 9.88E-01 -7.62E-02 -3.04E-01
Tibial muscular dystrophy 8C75 Muscle tissue 9.28E-03 -1.46E-01 -4.67E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.32E-01 4.44E-02 3.00E-01
Type 2 diabetes 5A11 Liver tissue 8.00E-01 8.60E-02 8.08E-01
Ureter cancer 2C92 Urothelium 2.80E-01 2.66E-02 1.70E-01
Uterine cancer 2C78 Endometrium tissue 4.92E-02 -1.07E-01 -3.19E-01
Vitiligo ED63.0 Skin 1.32E-01 2.54E-02 1.77E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases