Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTXK9WA)

DTP Name Very long-chain acyl-CoA synthetase (SLC27A2)
Gene Name SLC27A2
UniProt ID
O14975 (S27A2_HUMAN)
VARIDT ID
DTD0239
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms
ACSVL1; FACVL1; FATP-2; FATP2; Fatty acid transport protein 2; Fatty-acid-coenzyme A ligase, very long-chain 1; HsT17226; Long-chain-fatty-acid--CoA ligase; SLC27A2; Solute carrier family 27 member 2; THCA-CoA ligase; VLACS; VLCS; Very long-chain-fatty-acid-CoA ligase; hFACVL1
DTP Family Fatty Acid Transporter (FAT) Family ;
Tissue Specificity Expressed in liver, kidney, placenta andpancreas.
Sequence
MLSAIYTVLAGLLFLPLLVNLCCPYFFQDIGYFLKVAAVGRRVRSYGKRRPARTILRAFL
EKARQTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWL
WLGLVKLGCAMACLNYNIRAKSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKKDDVSIY
YVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEVTFSTPALYIYTSGTTGLPKAAMITHQ
RIWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGATLALRTKFSASQFWDD
CRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYE
FYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKG
EVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDR
VGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGK
KLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAK
MYVPMTEDIYNAISAKTLKL
Function This transporter convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.
Endogenous Substrate(s) Fatty acids
TCDB ID
4.C.1.1.5
Gene ID
11001
KEGG Pathway
PPAR signaling pathway (hsa03320 )
Peroxisome (hsa04146 )
Insulin resistance (hsa04931 )
Reactome Pathway
Synthesis of bile acids and bile salts via 24-hydroxycholesterol (R-HSA-193775 )
Alpha-oxidation of phytanate (R-HSA-389599 )
Neutrophil degranulation (R-HSA-6798695 )
Peroxisomal protein import (R-HSA-9033241 )
Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol (R-HSA-193368 )
BioCyc Pathway
MetaCyc:HS06695-MON

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.64E-05 -3.25E-01 -4.37E-01
Adrenocortical carcinoma 2D11.Z Kidney 3.25E-02 -1.16E+00 -1.31E+00
Alopecia ED70 Skin from scalp 1.73E-03 3.53E-01 4.68E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.37E-07 -2.52E-01 -6.52E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 5.73E-01 4.65E-02 2.74E-01
Aortic stenosis BB70 Calcified aortic valve 3.85E-01 5.17E-02 2.01E-01
Apnea 7A40 Hyperplastic tonsil 4.12E-01 -3.45E-02 -4.49E-02
Arthropathy FA00-FA5Z Peripheral blood 2.00E-01 -6.60E-04 -4.04E-03
Asthma CA23 Nasal and bronchial airway 2.68E-03 -3.26E-01 -4.44E-01
Atopic dermatitis EA80 Skin 1.78E-02 -7.20E-01 -5.49E-01
Autism 6A02 Whole blood 6.44E-01 4.37E-02 2.57E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.95E-02 -9.75E-02 -8.68E-01
Autosomal dominant monocytopenia 4B04 Whole blood 6.22E-02 3.25E-01 2.47E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.38E-01 1.74E-01 3.56E-01
Batten disease 5C56.1 Whole blood 8.96E-02 1.10E-01 2.02E+00
Behcet's disease 4A62 Peripheral blood 1.36E-01 5.89E-02 3.58E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 8.61E-01 1.00E-01 1.60E-01
Bladder cancer 2C94 Bladder tissue 3.37E-01 -6.95E-01 -7.83E-01
Breast cancer 2C60-2C6Z Breast tissue 3.02E-08 6.05E-01 4.14E-01
Cardioembolic stroke 8B11.20 Whole blood 3.09E-03 3.29E-01 6.76E-01
Cervical cancer 2C77 Cervical tissue 3.23E-01 1.58E-01 2.86E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 5.11E-01 9.28E-03 5.94E-02
Chronic hepatitis C 1E51.1 Whole blood 9.46E-01 -1.91E-01 -6.25E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 8.90E-01 -4.86E-02 -6.94E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.39E-01 -1.18E-01 -3.19E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.61E-01 -1.38E+00 -7.73E-01
Colon cancer 2B90 Colon tissue 1.03E-27 -5.49E-01 -9.70E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.96E-01 4.63E-02 3.69E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 1.22E-01 7.00E-01 1.21E+00
Endometriosis GA10 Endometrium tissue 8.45E-02 -1.12E-01 -3.96E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 8.04E-01 -1.14E-02 -1.61E-02
Familial hypercholesterolemia 5C80.00 Whole blood 5.67E-02 -8.72E-02 -4.92E-01
Gastric cancer 2B72 Gastric tissue 3.40E-02 2.49E+00 3.37E+00
Glioblastopma 2A00.00 Nervous tissue 1.87E-22 -5.90E-01 -1.13E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.10E-01 6.45E-02 3.83E-01
Head and neck cancer 2D42 Head and neck tissue 1.58E-17 -1.66E+00 -6.00E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 7.79E-02 -1.84E-01 -6.90E-01
Huntington's disease 8A01.10 Whole blood 3.42E-01 9.11E-02 8.51E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.22E-01 8.83E-01 7.61E-01
Immunodeficiency 4A00-4A20 Peripheral blood 4.83E-04 9.30E-01 4.75E+00
Influenza 1.00E+30 Whole blood 9.47E-03 1.38E+00 3.34E+00
Interstitial cystitis GC00.3 Bladder tissue 1.05E-02 -1.08E+00 -1.98E+00
Intracranial aneurysm 8B01.0 Intracranial artery 7.29E-01 4.03E-02 1.86E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.14E-01 -1.24E-02 -2.96E-02
Ischemic stroke 8B11 Peripheral blood 8.88E-01 -1.57E-02 -6.32E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 3.08E-01 -6.20E-02 -1.76E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 9.41E-01 3.12E-02 3.17E-01
Lateral sclerosis 8B60.4 Skin 2.82E-01 6.05E-02 9.23E-01
Liver cancer 2C12.0 Liver tissue 8.39E-36 -1.51E+00 -3.07E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.63E-02 -3.45E+00 -6.07E+00
Lung cancer 2C25 Lung tissue 9.52E-18 1.09E+00 9.62E-01
Lupus erythematosus 4A40 Whole blood 6.14E-03 1.04E-01 2.76E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.82E-01 3.48E-02 1.06E-01
Major depressive disorder 6A70-6A7Z Hippocampus 9.45E-01 2.21E-02 3.42E-02
Melanoma 2C30 Skin 2.98E-04 -3.08E+00 -1.48E+00
Multiple myeloma 2A83.1 Bone marrow 2.32E-01 -1.17E-01 -1.03E+00
Multiple myeloma 2A83.1 Peripheral blood 5.93E-01 4.56E-02 1.75E-02
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.42E-01 2.53E-01 9.07E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 5.37E-02 4.01E-01 8.51E-01
Myelofibrosis 2A20.2 Whole blood 8.81E-03 2.65E-01 2.39E+00
Myocardial infarction BA41-BA50 Peripheral blood 5.58E-01 1.35E-01 1.87E-01
Myopathy 8C70.6 Muscle tissue 3.20E-01 7.63E-03 9.24E-02
Neonatal sepsis KA60 Whole blood 1.74E-05 1.04E-01 4.63E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.24E-09 3.20E-01 1.74E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.36E-02 6.12E-01 1.60E+00
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.25E-01 -1.91E-02 -3.10E-02
Olive pollen allergy CA08.00 Peripheral blood 4.02E-01 -4.79E-01 -5.38E-01
Oral cancer 2B6E Oral tissue 4.38E-02 -3.37E-01 -3.47E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.50E-02 -4.96E-02 -3.03E-01
Osteoporosis FB83.1 Bone marrow 4.11E-01 1.06E-01 1.61E+00
Ovarian cancer 2C73 Ovarian tissue 2.55E-01 7.50E-01 5.37E-01
Pancreatic cancer 2C10 Pancreas 3.61E-01 -6.41E-01 -8.07E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 4.00E-01 3.08E-02 3.58E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.91E-03 2.69E-01 1.25E+00
Pituitary cancer 2D12 Pituitary tissue 4.67E-05 -1.44E+00 -1.94E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 2.12E-04 -1.43E+00 -2.21E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.10E-02 5.25E-02 5.83E-01
Polycythemia vera 2A20.4 Whole blood 5.54E-01 -4.20E-03 -3.58E-02
Pompe disease 5C51.3 Biceps muscle 2.41E-01 -4.97E-02 -5.19E-01
Preterm birth KA21.4Z Myometrium 5.24E-01 3.30E-02 3.67E-01
Prostate cancer 2C82 Prostate 9.32E-03 1.05E+00 1.02E+00
Psoriasis EA90 Skin 6.79E-10 -9.38E-01 -9.75E-01
Rectal cancer 2B92 Rectal colon tissue 6.02E-02 -3.77E-01 -6.92E-01
Renal cancer 2C90-2C91 Kidney 9.19E-03 -2.36E+00 -1.44E+00
Retinoblastoma 2D02.2 Uvea 1.41E-05 -1.07E+00 -2.27E+00
Rheumatoid arthritis FA20 Synovial tissue 1.65E-01 -2.37E-01 -8.79E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.12E-02 -2.87E-01 -6.02E-01
Schizophrenia 6A20 Prefrontal cortex 1.33E-01 -2.26E-01 -3.07E-01
Schizophrenia 6A20 Superior temporal cortex 6.78E-02 6.04E-02 4.23E-01
Scleroderma 4A42.Z Whole blood 9.94E-01 -2.84E-02 -1.46E-01
Seizure 8A60-8A6Z Whole blood 1.59E-01 6.18E-02 1.47E-01
Sensitive skin EK0Z Skin 1.76E-01 -4.15E-01 -1.56E+00
Sepsis with septic shock 1G41 Whole blood 3.00E-11 8.94E-02 3.69E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 8.03E-02 -4.24E-01 -9.00E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 2.80E-02 5.00E-02 5.26E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.84E-02 -6.48E-02 -3.34E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.77E-05 5.18E-01 1.77E+01
Skin cancer 2C30-2C3Z Skin 2.03E-36 -1.38E+00 -1.15E+00
Thrombocythemia 3B63 Whole blood 6.76E-02 6.90E-02 5.75E-01
Thrombocytopenia 3B64 Whole blood 9.75E-01 -6.50E-02 -2.33E-01
Thyroid cancer 2D10 Thyroid 5.06E-01 2.79E-01 4.48E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.79E-03 -1.20E-01 -7.55E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.48E-02 -6.18E-01 -2.11E+00
Type 2 diabetes 5A11 Liver tissue 6.57E-01 1.68E-01 5.07E-01
Ureter cancer 2C92 Urothelium 6.58E-01 -1.81E-02 -8.07E-02
Uterine cancer 2C78 Endometrium tissue 9.23E-15 5.90E-01 8.76E-01
Vitiligo ED63.0 Skin 7.12E-01 -4.44E-01 -5.10E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases