General Information of Drug Transporter (DTP) (ID: DTYNQ50)

DTP Name Magnesium transporter NIPA1 (SLC57A1)
Gene Name SLC57A1
UniProt ID
Q7RTP0 (NIPA1_HUMAN)
VARIDT ID
DTD0408
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms FSP3; NIPA1; Non-imprinted in Prader-Willi/Angelman syndrome region protein 1; SLC57A1; SPG6; Spastic paraplegia 6 protein
DTP Family Drug/Metabolite Transporter (DMT) Superfamily
NIPA Mg2+ Uptake Permease (NIPA) Family
Sequence
MGTAAAAAAAAAAAAAGEGARSPSPAAVSLGLGVAVVSSLVNGSTFVLQKKGIVRAKRRG
TSYLTDIVWWAGTIAMAVGQIGNFLAYTAVPTVLVTPLGALGVPFGSILASYLLKEKLNI
LGKLGCLLSCAGSVVLIIHSPKSESVTTQAELEEKLTNPVFVGYLCIVLLMLLLLIFWIA
PAHGPTNIMVYISICSLLGSFTVPSTKGIGLAAQDILHNNPSSQRALCLCLVLLAVLGCS
IIVQFRYINKALECFDSSVFGAIYYVVFTTLVLLASAILFREWSNVGLVDFLGMACGFTT
VSVGIVLIQVFKEFNFNLGEMNKSNMKTD
Function This tranaporter mediates the transport of divalent cations such as Mg(2+), Fe(2+), Sr(2+), Ba(2+), Mn(2+), Cu(2+) and Co(2+) but to a much less extent than Mg(2+).
Endogenous Substrate(s) Mg2+
TCDB ID
2.A.7.25.1
Gene ID
123606
Reactome Pathway
Miscellaneous transport and binding events (R-HSA-5223345 )

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.08E-20 2.18E-01 1.10E+00
Adrenocortical carcinoma 2D11.Z Kidney 1.18E-02 3.96E-02 1.24E-01
Alopecia ED70 Skin from scalp 3.63E-01 1.80E-03 7.68E-03
Alzheimer's disease 8A20 Entorhinal cortex 3.33E-04 -1.56E-01 -3.56E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.15E-01 2.69E-01 9.56E-01
Aortic stenosis BB70 Calcified aortic valve 8.36E-01 7.89E-02 1.64E-01
Apnea 7A40 Hyperplastic tonsil 6.20E-01 7.88E-02 2.31E-01
Arthropathy FA00-FA5Z Peripheral blood 1.75E-01 -5.84E-02 -2.45E-01
Asthma CA23 Nasal and bronchial airway 1.75E-01 6.44E-02 8.87E-02
Atopic dermatitis EA80 Skin 5.24E-01 -4.48E-02 -4.80E-01
Autism 6A02 Whole blood 5.33E-01 1.17E-02 5.58E-02
Autoimmune uveitis 9A96 Peripheral monocyte 3.41E-01 -1.51E-02 -9.34E-02
Autosomal dominant monocytopenia 4B04 Whole blood 9.90E-01 -2.97E-02 -1.58E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.46E-07 1.64E-01 8.12E-01
Batten disease 5C56.1 Whole blood 3.67E-01 1.55E-01 6.58E-01
Behcet's disease 4A62 Peripheral blood 6.56E-01 -5.01E-02 -2.40E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 6.46E-01 7.60E-02 3.24E-01
Bladder cancer 2C94 Bladder tissue 4.69E-01 -9.88E-02 -6.85E-01
Breast cancer 2C60-2C6Z Breast tissue 3.02E-59 4.07E-01 1.27E+00
Cardioembolic stroke 8B11.20 Whole blood 1.92E-04 -2.24E-01 -1.40E+00
Cervical cancer 2C77 Cervical tissue 3.77E-03 2.35E-01 1.06E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.97E-01 -3.28E-02 -5.81E-02
Chronic hepatitis C 1E51.1 Whole blood 9.15E-02 -1.70E-01 -9.00E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.31E-01 3.03E-02 1.84E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.74E-03 -1.34E-01 -6.13E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.01E-01 -1.30E-02 -8.27E-02
Colon cancer 2B90 Colon tissue 5.38E-10 1.62E-01 6.07E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.74E-01 -1.45E-01 -1.17E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 2.27E-01 -2.52E-01 -6.24E-01
Endometriosis GA10 Endometrium tissue 2.31E-01 -4.12E-02 -7.55E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 5.66E-01 6.43E-02 3.66E-01
Familial hypercholesterolemia 5C80.00 Whole blood 3.43E-02 -2.40E-01 -1.30E+00
Gastric cancer 2B72 Gastric tissue 6.05E-01 -4.05E-02 -7.81E-02
Glioblastopma 2A00.00 Nervous tissue 2.79E-144 -1.09E+00 -2.09E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 8.47E-03 -5.56E-01 -9.62E-01
Head and neck cancer 2D42 Head and neck tissue 8.04E-11 2.70E-01 1.04E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.03E-01 -3.77E-02 -1.21E-01
Huntington's disease 8A01.10 Whole blood 2.71E-01 -1.17E-01 -5.91E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.45E-01 -7.14E-02 -4.56E-01
Immunodeficiency 4A00-4A20 Peripheral blood 9.74E-01 -5.29E-02 -1.95E-01
Influenza 1.00E+30 Whole blood 1.40E-01 -5.83E-01 -2.18E+00
Interstitial cystitis GC00.3 Bladder tissue 1.29E-01 5.19E-02 1.54E+00
Intracranial aneurysm 8B01.0 Intracranial artery 2.00E-01 -9.31E-02 -4.93E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.49E-01 1.01E-02 5.06E-02
Ischemic stroke 8B11 Peripheral blood 2.77E-02 9.45E-02 4.86E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 9.66E-01 -8.79E-02 -2.20E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.23E-01 -1.43E-01 -3.13E-01
Lateral sclerosis 8B60.4 Skin 6.30E-01 3.90E-02 1.46E-01
Liver cancer 2C12.0 Liver tissue 1.34E-04 1.60E-01 5.30E-01
Liver failure DB99.7-DB99.8 Liver tissue 2.05E-06 -6.00E-01 -3.79E+00
Lung cancer 2C25 Lung tissue 2.79E-29 1.89E-01 8.22E-01
Lupus erythematosus 4A40 Whole blood 6.09E-01 8.54E-02 1.19E-01
Major depressive disorder 6A70-6A7Z Whole blood 4.23E-01 -2.01E-02 -7.54E-02
Major depressive disorder 6A70-6A7Z Hippocampus 6.90E-01 -1.12E-01 -5.22E-01
Melanoma 2C30 Skin 2.87E-01 2.35E-02 4.27E-02
Multiple myeloma 2A83.1 Bone marrow 3.54E-02 1.26E-01 7.40E-01
Multiple myeloma 2A83.1 Peripheral blood 9.68E-01 -1.01E-01 -4.28E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 1.12E-01 3.48E-01 9.97E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.96E-01 -3.90E-03 -1.13E-02
Myelofibrosis 2A20.2 Whole blood 4.82E-03 7.94E-02 4.75E-01
Myocardial infarction BA41-BA50 Peripheral blood 3.48E-02 -4.01E-01 -5.42E-01
Myopathy 8C70.6 Muscle tissue 3.40E-01 -6.85E-02 -3.05E-01
Neonatal sepsis KA60 Whole blood 5.39E-12 -3.83E-01 -1.24E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.08E-07 -1.35E+00 -3.34E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.31E-01 -4.07E-02 -3.51E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.99E-01 -1.30E-01 -1.10E+00
Olive pollen allergy CA08.00 Peripheral blood 4.08E-01 -3.06E-01 -5.44E-01
Oral cancer 2B6E Oral tissue 5.07E-07 3.06E-01 1.14E+00
Osteoarthritis FA00-FA0Z Synovial tissue 3.76E-02 2.57E-01 1.11E+00
Osteoporosis FB83.1 Bone marrow 3.60E-01 -1.16E-01 -3.12E-01
Ovarian cancer 2C73 Ovarian tissue 4.05E-04 7.63E-01 2.16E+00
Pancreatic cancer 2C10 Pancreas 1.59E-04 3.46E-01 1.36E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 5.80E-01 -6.23E-02 -2.04E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 3.63E-01 -7.41E-02 -4.30E-01
Pituitary cancer 2D12 Pituitary tissue 4.28E-04 4.77E-01 1.58E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.05E-01 2.08E-01 8.73E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.61E-01 2.51E-02 2.28E-01
Polycythemia vera 2A20.4 Whole blood 1.02E-03 1.10E-01 7.02E-01
Pompe disease 5C51.3 Biceps muscle 4.96E-01 1.03E-01 6.09E-01
Preterm birth KA21.4Z Myometrium 9.98E-01 -1.46E-01 -4.87E-01
Prostate cancer 2C82 Prostate 3.87E-08 1.17E+00 1.92E+00
Psoriasis EA90 Skin 5.75E-12 1.29E-01 3.68E-01
Rectal cancer 2B92 Rectal colon tissue 3.72E-01 1.28E-01 4.53E-01
Renal cancer 2C90-2C91 Kidney 2.60E-03 1.71E-01 8.63E-01
Retinoblastoma 2D02.2 Uvea 8.55E-01 -2.33E-02 -5.86E-02
Rheumatoid arthritis FA20 Synovial tissue 2.22E-04 1.92E-01 1.73E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 5.80E-01 3.80E-02 2.27E-01
Schizophrenia 6A20 Prefrontal cortex 1.75E-03 -2.99E-01 -4.47E-01
Schizophrenia 6A20 Superior temporal cortex 7.60E-02 -1.61E-01 -6.45E-01
Scleroderma 4A42.Z Whole blood 1.72E-02 -2.27E-01 -1.72E+00
Seizure 8A60-8A6Z Whole blood 7.53E-01 1.62E-02 6.03E-02
Sensitive skin EK0Z Skin 8.32E-01 7.75E-03 7.77E-02
Sepsis with septic shock 1G41 Whole blood 9.64E-63 -4.90E-01 -2.10E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.34E-01 2.21E-01 8.30E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.24E-03 8.17E-01 2.21E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 5.23E-01 -2.46E-01 -9.84E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.21E-01 8.38E-02 2.99E-01
Skin cancer 2C30-2C3Z Skin 1.60E-31 6.62E-01 1.49E+00
Thrombocythemia 3B63 Whole blood 1.47E-02 1.03E-01 6.20E-01
Thrombocytopenia 3B64 Whole blood 7.82E-01 2.30E-02 2.90E-02
Thyroid cancer 2D10 Thyroid 4.21E-01 -6.90E-02 -3.29E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.69E-03 -1.43E-01 -1.00E+00
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.17E-02 -3.91E-01 -1.88E+00
Type 2 diabetes 5A11 Liver tissue 3.26E-01 1.98E-01 1.02E+00
Ureter cancer 2C92 Urothelium 8.51E-01 3.21E-02 2.66E-01
Uterine cancer 2C78 Endometrium tissue 3.22E-16 3.96E-01 1.21E+00
Vitiligo ED63.0 Skin 5.38E-01 3.62E-02 6.39E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases