Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DTZAH46)

DTP Name Sodium/iodide cotransporter (SLC5A5)
Gene Name SLC5A5
UniProt ID
Q92911 (SC5A5_HUMAN)
VARIDT ID
DTD0425
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Synonyms NIS; Na(+)/I(-) cotransporter; Na(+)/I(-) symporter; SLC5A5; Sodium-iodide symporter; Solute carrier family 5 member 5; TDH1
DTP Family Solute:Sodium Symporter (SSS) Family ;
Tissue Specificity Expression is primarily in thyroid tissue, butalso to a lower extent in mammary gland and ovary. Expression isreduced in tumors.
Sequence
MEAVETGERPTFGAWDYGVFALMLLVSTGIGLWVGLARGGQRSAEDFFTGGRRLAALPVG
LSLSASFMSAVQVLGVPSEAYRYGLKFLWMCLGQLLNSVLTALLFMPVFYRLGLTSTYEY
LEMRFSRAVRLCGTLQYIVATMLYTGIVIYAPALILNQVTGLDIWASLLSTGIICTFYTA
VGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSRINLMDFNPDPRS
RYTFWTFVVGGTLVWLSMYGVNQAQVQRYVACRTEKQAKLALLINQVGLFLIVSSAACCG
IVMFVFYTDCDPLLLGRISAPDQYMPLLVLDIFEDLPGVPGLFLACAYSGTLSTASTSIN
AMAAVTVEDLIKPRLRSLAPRKLVIISKGLSLIYGSACLTVAALSSLLGGGVLQGSFTVM
GVISGPLLGAFILGMFLPACNTPGVLAGLGAGLALSLWVALGATLYPPSEQTMRVLPSSA
ARCVALSVNASGLLDPALLPANDSSRAPSSGMDASRPALADSFYAISYLYYGALGTLTTV
LCGALISCLTGPTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKK
PPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL
Function This transporter mediates iodide uptake in the thyroid gland.
Endogenous Substrate(s) Br-; Bromate; Chlorate; Periodate; Selenium cyanide; Sodium iodide; Tetrafluoroborate; Thiocyanate
TCDB ID
2.A.21.5.1
Gene ID
6528
KEGG Pathway
Thyroid hormone synthesis (hsa04918 )
Reactome Pathway
Organic anion transporters (R-HSA-428643 )
Defective SLC5A5 causes thyroid dyshormonogenesis 1 (TDH1) (R-HSA-5619096 )
Thyroxine biosynthesis (R-HSA-209968 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTP
1 Investigative Drug(s) Transported by This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
NITRATE DMVFB93 Discovery agent N.A. Investigative [2]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTP
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.96E-04 1.11E-01 3.23E-01
Adrenocortical carcinoma 2D11.Z Kidney 1.96E-01 -4.48E-02 -1.39E-01
Alopecia ED70 Skin from scalp 3.88E-01 -7.30E-02 -3.31E-01
Alzheimer's disease 8A20 Entorhinal cortex 6.41E-02 -2.55E-02 -1.04E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 7.36E-01 -4.45E-02 -5.38E-01
Aortic stenosis BB70 Calcified aortic valve 7.16E-01 3.05E-02 4.28E-02
Apnea 7A40 Hyperplastic tonsil 3.61E-03 -4.94E-01 -2.16E+00
Arthropathy FA00-FA5Z Peripheral blood 6.30E-01 5.63E-02 3.89E-01
Asthma CA23 Nasal and bronchial airway 6.79E-01 -1.97E-01 -3.24E-01
Atopic dermatitis EA80 Skin 1.14E-02 9.74E-02 7.13E-01
Autism 6A02 Whole blood 2.13E-02 -1.77E-01 -6.07E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.14E-01 -7.43E-02 -4.40E-01
Autosomal dominant monocytopenia 4B04 Whole blood 3.64E-01 -3.81E-02 -2.32E-01
Bacterial infection of gingival 1C1H Gingival tissue 9.55E-01 -4.27E-02 -1.32E-01
Batten disease 5C56.1 Whole blood 5.21E-01 1.42E-01 1.36E+00
Behcet's disease 4A62 Peripheral blood 6.88E-01 4.70E-02 1.87E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.11E-01 -3.92E-02 -2.14E-01
Bladder cancer 2C94 Bladder tissue 2.69E-05 7.06E-01 3.65E+00
Breast cancer 2C60-2C6Z Breast tissue 7.70E-16 -2.18E-01 -5.48E-01
Cardioembolic stroke 8B11.20 Whole blood 2.30E-03 9.89E-02 5.92E-01
Cervical cancer 2C77 Cervical tissue 2.42E-01 -2.38E-02 -7.48E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 1.14E-01 5.21E-02 1.89E-01
Chronic hepatitis C 1E51.1 Whole blood 3.07E-01 1.34E-01 5.54E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.01E-02 1.85E-01 7.22E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 4.16E-01 8.75E-02 2.89E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.21E-02 9.81E-02 1.33E+00
Colon cancer 2B90 Colon tissue 2.04E-15 -2.15E-01 -8.02E-01
Coronary artery disease BA80-BA8Z Peripheral blood 1.21E-01 4.50E-02 5.74E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.45E-01 -1.78E-01 -5.56E-01
Endometriosis GA10 Endometrium tissue 6.95E-01 3.16E-02 1.02E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 7.70E-01 -5.29E-02 -2.24E-01
Familial hypercholesterolemia 5C80.00 Whole blood 4.64E-03 -2.19E-01 -8.77E-01
Gastric cancer 2B72 Gastric tissue 2.31E-01 -8.08E-01 -1.53E+00
Glioblastopma 2A00.00 Nervous tissue 7.02E-08 -9.83E-02 -3.00E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.52E-08 -9.51E-01 -4.69E+00
Head and neck cancer 2D42 Head and neck tissue 6.91E-06 1.26E-01 4.68E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 2.63E-03 -1.30E-01 -6.48E-01
Huntington's disease 8A01.10 Whole blood 2.18E-01 7.81E-02 3.19E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 1.46E-01 3.08E-02 1.32E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.63E-01 4.81E-02 3.89E-01
Influenza 1.00E+30 Whole blood 2.17E-01 2.81E-01 1.54E+00
Interstitial cystitis GC00.3 Bladder tissue 5.81E-01 9.83E-02 4.91E-01
Intracranial aneurysm 8B01.0 Intracranial artery 9.25E-01 1.14E-01 3.32E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.64E-01 6.41E-02 1.64E-01
Ischemic stroke 8B11 Peripheral blood 2.80E-01 4.87E-02 2.56E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 8.79E-01 -2.59E-03 -1.17E-02
Lateral sclerosis 8B60.4 Cervical spinal cord 6.44E-01 -1.41E-01 -4.48E-01
Lateral sclerosis 8B60.4 Skin 2.85E-01 1.44E-01 1.09E+00
Liver cancer 2C12.0 Liver tissue 2.10E-04 -2.58E-01 -7.42E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.75E-01 1.05E-01 5.59E-01
Lung cancer 2C25 Lung tissue 4.91E-01 -1.43E-02 -4.82E-02
Lupus erythematosus 4A40 Whole blood 9.71E-03 -1.65E-01 -2.12E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.29E-01 4.97E-02 2.26E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.17E-01 -1.06E-03 -5.56E-03
Melanoma 2C30 Skin 5.88E-01 1.48E-02 1.30E-02
Multiple myeloma 2A83.1 Bone marrow 4.95E-04 -3.46E-01 -2.18E+00
Multiple myeloma 2A83.1 Peripheral blood 6.09E-01 2.68E-02 2.13E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.05E-01 6.03E-04 2.06E-03
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.52E-01 -8.94E-02 -3.56E-01
Myelofibrosis 2A20.2 Whole blood 8.79E-01 -4.82E-02 -3.09E-01
Myocardial infarction BA41-BA50 Peripheral blood 8.02E-02 8.69E-01 1.01E+00
Myopathy 8C70.6 Muscle tissue 4.34E-02 -2.23E-01 -1.09E+00
Neonatal sepsis KA60 Whole blood 7.11E-05 -1.27E-01 -3.91E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.33E-03 -4.87E-01 -1.68E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 7.81E-01 -6.00E-02 -3.01E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.51E-02 1.41E-01 1.46E+00
Olive pollen allergy CA08.00 Peripheral blood 1.89E-01 3.30E-01 9.00E-01
Oral cancer 2B6E Oral tissue 5.83E-05 -2.88E-01 -8.93E-01
Osteoarthritis FA00-FA0Z Synovial tissue 9.06E-01 3.28E-02 1.11E-01
Osteoporosis FB83.1 Bone marrow 1.73E-04 6.64E-01 3.77E+00
Ovarian cancer 2C73 Ovarian tissue 3.15E-01 -2.45E-01 -6.71E-01
Pancreatic cancer 2C10 Pancreas 1.30E-01 -1.92E-01 -4.74E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 2.58E-01 -1.22E-01 -4.90E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.28E-01 -6.22E-02 -3.52E-01
Pituitary cancer 2D12 Pituitary tissue 1.14E-01 4.74E-01 1.19E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 6.70E-01 1.75E-03 4.91E-03
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 6.42E-01 1.02E-02 6.57E-02
Polycythemia vera 2A20.4 Whole blood 6.38E-01 -2.29E-02 -1.31E-01
Pompe disease 5C51.3 Biceps muscle 1.76E-01 -2.25E-01 -1.11E+00
Preterm birth KA21.4Z Myometrium 2.95E-01 -3.28E-03 -2.21E-02
Prostate cancer 2C82 Prostate 7.01E-04 -1.48E+00 -1.37E+00
Psoriasis EA90 Skin 3.54E-11 -2.53E-01 -4.95E-01
Rectal cancer 2B92 Rectal colon tissue 1.36E-01 -2.78E-01 -8.17E-01
Renal cancer 2C90-2C91 Kidney 3.01E-02 -3.41E-01 -1.15E+00
Retinoblastoma 2D02.2 Uvea 4.17E-02 -1.95E-01 -1.29E+00
Rheumatoid arthritis FA20 Synovial tissue 2.61E-01 -1.42E-01 -5.94E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 6.58E-01 1.44E-02 8.85E-02
Schizophrenia 6A20 Prefrontal cortex 8.49E-01 4.69E-03 1.68E-02
Schizophrenia 6A20 Superior temporal cortex 9.87E-01 -1.23E-02 -8.36E-02
Scleroderma 4A42.Z Whole blood 6.66E-04 3.34E-01 1.76E+00
Seizure 8A60-8A6Z Whole blood 1.11E-01 -2.10E-01 -8.11E-01
Sensitive skin EK0Z Skin 5.85E-01 -7.48E-02 -3.95E-01
Sepsis with septic shock 1G41 Whole blood 1.82E-02 -2.04E-02 -6.11E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.61E-01 3.69E-01 7.61E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 4.41E-01 1.43E-01 4.61E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 8.24E-01 -6.47E-02 -9.59E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 4.54E-01 -1.56E-01 -2.61E-01
Skin cancer 2C30-2C3Z Skin 4.16E-10 -4.10E-01 -5.64E-01
Thrombocythemia 3B63 Whole blood 4.84E-01 5.16E-02 3.11E-01
Thrombocytopenia 3B64 Whole blood 4.54E-01 -8.07E-02 -2.83E-01
Thyroid cancer 2D10 Thyroid 4.49E-14 -4.45E-01 -7.18E-01
Tibial muscular dystrophy 8C75 Muscle tissue 3.32E-01 -1.10E-01 -4.83E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.05E-01 4.77E-02 3.93E-01
Type 2 diabetes 5A11 Liver tissue 8.66E-01 -5.33E-15 -2.73E-14
Ureter cancer 2C92 Urothelium 7.50E-01 2.35E-02 1.34E-01
Uterine cancer 2C78 Endometrium tissue 5.43E-06 -2.43E-01 -8.42E-01
Vitiligo ED63.0 Skin 7.54E-02 -1.05E-01 -5.92E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name Sodium/iodide cotransporter (SLC5A5) DTT Info
DTP DTT Type Clinical trial
1 Clinical Trial Drug(s) Targeting This DTP
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ad5CMV-NIS DMFTGHX Prostate cancer 2C82.0 Phase 1 [1]
------------------------------------------------------------------------------------

References

1 Noninvasive Imaging and Radiovirotherapy of Prostate Cancer Using an Oncolytic Measles Virus Expressing the Sodium Iodide Symporter. Mol Ther. 2009 December; 17(12): 2041-2048.
2 The Transporter Classification Database (TCDB): recent advances. Nucleic Acids Res. 2016 Jan 4;44(D1):D372-9. (ID: 2.A.21.5.1)