Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT04YCM)
| DTT Name | Borealin (CDCA8) | ||||
|---|---|---|---|---|---|
| Synonyms |
hDasraB; hDasra-B; Pluripotent embryonic stem cellrelated gene 3 protein; Pluripotent embryonic stem cell-related gene 3 protein; PESCRG3; DasraB; Dasra-B; Dasra B; Cell division cycleassociated protein 8; Cell division cycle-associated protein 8
|
||||
| Gene Name | CDCA8 | ||||
| DTT Type |
Literature-reported target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MAPRKGSSRVAKTNSLRRRKLASFLKDFDREVEIRIKQIESDRQNLLKEVDNLYNIEILR
LPKALREMNWLDYFALGGNKQALEEAATADLDITEINKLTAEAIQTPLKSAKTRKVIQVD EMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVS MVKPTPGLTPRFDSRVFKTPGLRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLR LLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK |
||||
| Function |
The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Major effector of the TTK kinase in the control of attachment-error-correction and chromosome alignment. Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis.
|
||||
| Reactome Pathway |
|
||||