Details of the Drug Therapeutic Target (DTT)
General Information of Drug Therapeutic Target (DTT) (ID: TT08ESN)
| DTT Name | Mycobacterium Mycolic acid synthase (MycB cma) | ||||
|---|---|---|---|---|---|
| Synonyms |
cma; SAM-MT; S-adenosylmethionine-dependent methyltransferase; Mycolic acid methyltransferase; MA-MT; Cyclopropane-fatty-acyl-phospholipid synthase; Cyclopropane mycolic acid synthase; Cyclopropane fatty acid synthase; CMAS; CFA synthase; AdoMet-MT
|
||||
| Gene Name | MycB cmaA1 | ||||
| DTT Type |
Successful target
|
[1] | |||
| UniProt ID | |||||
| TTD ID | |||||
| 3D Structure | |||||
| Sequence |
MPDELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKL
GLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSENLRSKRVLL AGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHER GLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWS AALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK |
||||
| Function |
Catalyzes the conversion of a double bond to a cyclopropane ring at the distal position of an alpha mycolic acid via the transfer of a methylene group from S-adenosyl-L-methionine. Cyclopropanated mycolic acids are key factors participating in cell envelope permeability, host immunomodulation and persistence.
|
||||
Molecular Interaction Atlas (MIA) of This DTT
| Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
1 Approved Drug(s) Targeting This DTT
|
||||||||||||||||||||||||||||